KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_090Help
Entry
BUAMB_090         CDS       T01830                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUAMB_090 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BUAMB_090 (dapE)
Enzymes [BR:buh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BUAMB_090 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
96201..97328
Genome map
AA seq 375 aa AA seqDB search
MICSITKLAQQLISIPSISPQDLGCQNIIIKRLCSMGFTIKQININDTKNLWAFRGIGKT
LTFLGHTDVVSPGKYEDWDTNPFDPVIRNGFVFGRGASDMKGALASMIIASENFIKKFPY
HTGRLSFLITSDEESSAINGTTKVVEYLQNQNDIIDYCIVGEPSSTKTIGDVIKNGRRGS
ITANITINGMQGHIAYPHLADNPIHKALPIILKILSMKLDDGNEFFSPTSINIANIHSGE
GISNIIPKSLFVQFNIRFSTETSELKIQSQIINILNENKIDYSIKWDISGQPFLTKKGIL
IDTVMQSIKFFNKKKPILSTSGGTSDGRFIALMGAEVIELGLTNNTIHKINECVKISDLQ
ILSCIYEDIMKRLLT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttgctcaattactaaattagcacaacagttaatttctattccgtctattagtcca
caagatttaggttgtcaaaatattattattaaacgtttatgttccatgggatttacaatt
aaacaaattaatattaatgatacaaaaaatttatgggcttttagaggtattggaaaaaca
ttgacatttttaggacatacagatgtagtatcaccaggaaaatatgaagattgggataca
aatccttttgatccagtgattcgtaatggatttgtatttggtcgaggtgcttcagatatg
aaaggtgctttagcatctatgattatcgcttctgaaaattttataaaaaaatttccatat
catacaggacgattatcttttttaattacttcagatgaagaatcaagtgcaattaatggt
actacgaaagtagtagaatatttacaaaatcaaaatgatataattgactactgtatagta
ggagaaccatctagtactaaaacaattggagatgttataaaaaatggacgacgtggttct
attactgctaatattactattaatggaatgcaaggacatattgcgtatcctcatttagca
gataatccaatacataaagcattaccaattattcttaaaatattatctatgaagttagat
gatggaaatgaatttttttcaccaactagcataaatattgctaatattcattctggagaa
ggaattagtaacattattccgaaatcattatttgtgcaatttaatattcgttttagtaca
gaaacatcggaactaaaaattcaatcacaaattattaatatattaaatgaaaataaaatt
gattattcgataaaatgggatatttcagggcaaccttttcttactaagaaaggtatattg
atagatactgttatgcaatctattaaattttttaataaaaaaaaacctattttatctact
tcaggtggtacctctgatggtagatttattgctttaatgggagctgaagttattgaatta
ggtttaacaaataacacaattcataaaattaatgagtgtgtaaaaatatctgatttgcaa
atattaagttgtatttatgaagatataatgaaaagattactgacataa

DBGET integrated database retrieval system