KEGG   Buchnera aphidicola Ua: BUAMB_090Help
Entry
BUAMB_090         CDS       T01830                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
buh  Buchnera aphidicola Ua
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:buh01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:buh00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
96201..97328
Genome map
AA seq 375 aa AA seqDB search
MICSITKLAQQLISIPSISPQDLGCQNIIIKRLCSMGFTIKQININDTKNLWAFRGIGKT
LTFLGHTDVVSPGKYEDWDTNPFDPVIRNGFVFGRGASDMKGALASMIIASENFIKKFPY
HTGRLSFLITSDEESSAINGTTKVVEYLQNQNDIIDYCIVGEPSSTKTIGDVIKNGRRGS
ITANITINGMQGHIAYPHLADNPIHKALPIILKILSMKLDDGNEFFSPTSINIANIHSGE
GISNIIPKSLFVQFNIRFSTETSELKIQSQIINILNENKIDYSIKWDISGQPFLTKKGIL
IDTVMQSIKFFNKKKPILSTSGGTSDGRFIALMGAEVIELGLTNNTIHKINECVKISDLQ
ILSCIYEDIMKRLLT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttgctcaattactaaattagcacaacagttaatttctattccgtctattagtcca
caagatttaggttgtcaaaatattattattaaacgtttatgttccatgggatttacaatt
aaacaaattaatattaatgatacaaaaaatttatgggcttttagaggtattggaaaaaca
ttgacatttttaggacatacagatgtagtatcaccaggaaaatatgaagattgggataca
aatccttttgatccagtgattcgtaatggatttgtatttggtcgaggtgcttcagatatg
aaaggtgctttagcatctatgattatcgcttctgaaaattttataaaaaaatttccatat
catacaggacgattatcttttttaattacttcagatgaagaatcaagtgcaattaatggt
actacgaaagtagtagaatatttacaaaatcaaaatgatataattgactactgtatagta
ggagaaccatctagtactaaaacaattggagatgttataaaaaatggacgacgtggttct
attactgctaatattactattaatggaatgcaaggacatattgcgtatcctcatttagca
gataatccaatacataaagcattaccaattattcttaaaatattatctatgaagttagat
gatggaaatgaatttttttcaccaactagcataaatattgctaatattcattctggagaa
ggaattagtaacattattccgaaatcattatttgtgcaatttaatattcgttttagtaca
gaaacatcggaactaaaaattcaatcacaaattattaatatattaaatgaaaataaaatt
gattattcgataaaatgggatatttcagggcaaccttttcttactaagaaaggtatattg
atagatactgttatgcaatctattaaattttttaataaaaaaaaacctattttatctact
tcaggtggtacctctgatggtagatttattgctttaatgggagctgaagttattgaatta
ggtttaacaaataacacaattcataaaattaatgagtgtgtaaaaatatctgatttgcaa
atattaagttgtatttatgaagatataatgaaaagattactgacataa

DBGET integrated database retrieval system