KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_158Help
Entry
BUAMB_158         CDS       T01830                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00900  Terpenoid backbone biosynthesis
buh01100  Metabolic pathways
buh01110  Biosynthesis of secondary metabolites
buh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BUAMB_158 (ispE)
Enzymes [BR:buh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BUAMB_158 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEO07982
UniProt: G2LP45
Position
complement(174081..174950)
Genome map
AA seq 289 aa AA seqDB search
MKIKTIYTWWPSPAKINLFLYVTGIRPNRYHNIQTLFQFLNYGDKLKIIPNNTGNIQLFT
KNKHLLNKKNSIITAAKLLKKKGLLHKRLCNSLHGAQIFLKKNIPIGSGLGGGSSNAATT
LIVLNKLWNTQFTLQELSSFSLEIGSDIPGFIMGKTAIIEGIGDILYPIKQKEKWYVIIY
PNITISTKKMFSNLCFIKYTSKKSIQELLTLPFSNVFEEIAKNKFIKINQLISILSSYAP
FRMTGTGSCIFSEFNDKKSAQKIFQLIPKNTKSFITKSVNISPLHKIFN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaacaatctatacatggtggccatcacctgcaaaaattaatttattttta
tatgtaacaggtatacgtccaaatcggtatcataatatacaaacattatttcaattttta
aattatggtgataaattaaaaattattcctaataatacaggtaatattcaattatttact
aaaaataaacatctcttaaataaaaaaaatagtattattactgctgctaaattattaaaa
aaaaaaggattacttcataaaagattatgtaattctttacatggagcgcaaatattttta
aaaaaaaatatacctataggaagtggattaggaggcggttcatctaatgcagcaactaca
ttaattgttttaaataaattatggaatacacaatttactttacaagaactatcttcattt
agtctagaaataggatcagatatacctggttttattatgggaaaaacagcaattattgaa
ggaataggagatatattatatcctattaaacaaaaagaaaaatggtatgtaattatatat
cctaatattactatttcaacaaaaaaaatgttttccaatctttgttttatcaaatatact
tctaaaaaatctattcaagaattattgactttaccttttagtaatgtttttgaagaaata
gcaaaaaacaaatttattaaaataaaccaattaatttcaatattatcttcatatgctcca
tttcgaatgacaggtacaggttcgtgtatattttctgaatttaatgacaaaaaatctgca
caaaaaatatttcaactaataccaaaaaatacaaaaagttttataacaaaaagtgttaat
atttcaccattacacaaaatttttaattaa

DBGET integrated database retrieval system