KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_258Help
Entry
BUAMB_258         CDS       T01830                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUAMB_258 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUAMB_258 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BUAMB_258 (trpA)
Enzymes [BR:buh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BUAMB_258 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(288195..289004)
Genome map
AA seq 269 aa AA seqDB search
MSRYLNMFNKLAILKEGCFVPFVVLGDPSLEISINIINILIENGADALEIGIPFSDPLAD
GPIIQKANLRALDQNQNILKYFKILKKIREENISLPIGILIYANLVYNQGIDNFYLQCSN
SGLDSVLIADVPIEESKIFYHTANKYRIDSIFICPPNADDNFLYNLALYAKGYIYVLSRS
GVTGINHSTTLLSPELIKRIKKYNSLPLLQGFGISNPIQIKKAISSGLSGVICGSAIINI
IEKYLHQEEKMIKKIKKFTKLLKLSTKFQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatatttaaacatgtttaataaattagctattttaaaagaaggatgttttgtt
ccttttgtagttttaggagacccttctttagaaatttcaataaacattatcaatatttta
attgaaaatggggctgatgctttagaaattggtattccattttcagatccattagcagat
ggaccaattatccaaaaagcaaatttacgtgctctagatcaaaaccaaaatattttaaaa
tattttaaaatattaaaaaaaatacgcgaagaaaacataagtttacctatcggtatttta
atatatgctaatcttgtatataatcaaggtattgataatttttatttacaatgttctaat
tctggattagattcggtacttatagcagatgttcccattgaagaatcaaaaattttttat
catactgcaaataaatatcgcattgattctatttttatttgtcctccaaatgcagacgat
aattttttatataatcttgctttatatgcaaaaggttatatttatgtattatctcgttct
ggagtaactgggataaatcattcaacaacattattatcgccagagttgatcaaaagaata
aaaaaatataattctcttcctttattacaaggttttgggatttctaatcctatacaaata
aaaaaagcaatatcatctggtttatctggtgtaatatgcggttcagctattataaacata
attgaaaaatatttgcatcaagaagaaaaaatgataaaaaaaataaaaaaatttactaag
ctattaaagttgtctactaaatttcaataa

DBGET integrated database retrieval system