KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_259Help
Entry
BUAMB_259         CDS       T01830                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUAMB_259 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUAMB_259 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BUAMB_259 (trpB)
Enzymes [BR:buh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BUAMB_259 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(288979..290190)
Genome map
AA seq 403 aa AA seqDB search
MTLIHPYFGKFGGMFVPQILMPALLQLEKTFVSAQNSSAFKKKLNDLLKNYAGRPTPLTL
CKNLTKGTNTRLYLKREDLLHGGAHKTNQVLGQALLATKMKKKEIIAETGAGQHGVATAI
TCALLNLKCRIYMGIKDIKRQNSNVFRMKLMGAEVIPVKNGSGTLKDACNEALRDWSDTY
STSHYMIGTAAGPHPYPTIVREFQRIIGQETKQQILEYEKNLPDSIIACVGGGSNAIGIF
SDFIHDDKVNLIGVEPAGYGIETGKHGAPLKYGRTGIYFGMKSHLMQNEEGQIQNSWSIS
AGLDFPSVGPEHAWLNSINRAQYVSINDKEAVHAFQILCQKEGIIAALESSHALAYALKI
INAEPRKKQILVVNLSGRGDKDIFTVRNFLKKERYNESIFKHV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaattcatccttattttggtaaatttgggggtatgtttgtcccgcaaatatta
atgccagctttattgcaattagaaaaaacctttgtttctgctcaaaatagttctgcattt
aaaaaaaaacttaatgatttattaaaaaattacgcgggtagacctactccattaactttg
tgtaaaaatttaactaagggtacaaatactcgtctatatcttaaaagagaagatttatta
catggaggagcacataaaactaatcaagttttagggcaagctttattagctactaaaatg
aaaaaaaaggaaattattgcagaaactggagctggacaacatggtgtagctactgcgatt
acttgtgcattattaaatttaaaatgcagaatttatatgggaattaaagatattaaaaga
caaaattctaatgtatttcgtatgaaattaatgggagcggaagttataccagtaaaaaat
ggttcaggtacattaaaagacgcatgtaatgaagcattacgtgattggtccgatacttat
agtacatctcattatatgattggaactgcagctggtccacatccttaccctactattgtt
cgcgaatttcaaagaattattggtcaagaaacaaaacagcaaattttagaatatgaaaaa
aacttaccagattcaattattgcatgtgtaggtggtgggtctaatgccattggcatattt
tcagattttattcatgatgataaagtgaatttaattggcgtagaaccagcaggttatgga
attgaaacgggaaaacatggtgcaccattaaaatatggtagaactggcatttatttcggt
atgaaatcacatttaatgcaaaatgaagaaggtcaaattcaaaattcttggtcaatatcc
gcaggactagattttccatctgttggtcctgaacatgcttggttaaatagtattaatcgt
gctcaatatgtttcaattaatgataaagaagcagtacatgcatttcaaatattatgtcaa
aaagaaggtattattgctgctttagaatcttctcatgctttagcatatgcattaaaaata
ataaatgcagaacctagaaagaaacaaattttagttgttaatctctctggtcgtggtgat
aaagacatttttactgttcgcaattttttaaaaaaagagagatataatgagtcgatattt
aaacatgtttaa

DBGET integrated database retrieval system