KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_284Help
Entry
BUAMB_284         CDS       T01830                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUAMB_284 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUAMB_284 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BUAMB_284 (sucB)
Enzymes [BR:buh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BUAMB_284 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322153..323337
Genome map
AA seq 394 aa AA seqDB search
MKKINILVPELPESINNATIVRWHKKIGDIVYYNDNIVDLETDKVTLEVSAPCNGILQLI
LEKEGKIVNSHQILGEIDQLDIIKNNTINHKLSEKKKYLPDSQKKFINKEQINCVVSKNK
EYLTPSIRRSIKKNKININNQIIFNDILDSNHNKLNEVTLNNNITKRVKMTQLRQTIAKR
LLDSKNNTAMLTTFNEVNMNPIITLRKKYGEDFKKKHGIRMGFMSFFVKATVEALKQFPQ
INAYIDETDIVFYKNFNINIAISTPRGLITPVLKNVENMTMSDIEKKIKELSIKGYENKL
NITELTGGNFTITNGGIFGSLMSTPIINPPQAAILGMHVIQKRPVVINEKIEILPMMYLA
LSYDHRLIDGKESVGFLIAIKNILEDFVRILINV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaatattcttgttccagaattaccagaatctattaacaatgcaacaatt
gtaagatggcataaaaaaatcggagatatagtttactataatgataatatagtagatctt
gaaacagataaagtaacattagaagtatctgctccatgtaatggtatattgcaattaatt
ttagagaaagaaggtaaaatagttaactctcatcaaatattaggagaaatagaccaatta
gatatcataaaaaataatactattaatcacaagctttcagaaaaaaaaaaatatttacca
gattcacaaaaaaagtttataaataaggaacaaattaattgtgttgtttcaaaaaataaa
gagtatcttactccatctataagacgttcaattaaaaaaaataaaattaatattaataat
caaataatttttaatgatattttagatagtaatcacaataaattaaatgaagttacatta
aataataatattacaaaaagagtcaaaatgactcaattaagacaaactattgcaaaaaga
ttattagatagcaaaaataatacagctatgctaacaacttttaatgaagtaaatatgaat
cctataatcactttaagaaaaaagtatggtgaagattttaaaaaaaaacatggtattcgt
atgggatttatgtctttttttgttaaagccacagtagaagcgttaaaacaatttccgcaa
attaatgcttatatagatgaaacagatatagtattttataaaaattttaatataaatatt
gctatttcaacaccaagaggtttaattacacctgtattaaaaaatgttgaaaatatgacc
atgtcggatatagaaaaaaaaataaaggaattatctattaaaggttatgagaataaattg
aatattacagaattaacaggtggaaattttactattactaatggtggtatttttggatct
ttaatgtctactcctatcattaatcctccccaagcagctatattaggtatgcatgttatt
caaaaacgtccagtagttataaatgaaaaaattgaaattcttccaatgatgtatttagca
ttatcatatgatcatcgtttaatagacggcaaagaatctgttggttttttaattgctata
aaaaatatattagaagattttgttcgaattttaatcaatgtataa

DBGET integrated database retrieval system