KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_285Help
Entry
BUAMB_285         CDS       T01830                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUAMB_285 (gpmA)
   01230 Biosynthesis of amino acids
    BUAMB_285 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUAMB_285 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BUAMB_285 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUAMB_285 (gpmA)
Enzymes [BR:buh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BUAMB_285 (gpmA)
Exosome [BR:buh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BUAMB_285 (gpmA)
  Exosomal proteins of melanoma cells
   BUAMB_285 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323439..324134
Genome map
AA seq 231 aa AA seqDB search
MKSNKVVLIRHGQSIWNELNKFTGWYDATLSENGKNEAKSAAILLKKNKFSFDYAYTSVL
KRAIYTLRYILDELNQNWILVKKSWCLNERHYGALEGLNKDEVIKKYGEKQVLLWRRSFN
IIPPKIDIQDKRFPGNDLRYSNLNISDIPLGESLEMTSKRVIPYWKTVIYPQLKNNKKIL
IVAHGNSLRALIQYLNNITNKDIIKLNIPTAVPIVLEFNQNNSLIQWYYLK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaataaagtagtcttaattagacatggtcaaagtatttggaatgaattaaat
aaatttactggatggtatgatgcgacattatcagaaaatggaaaaaatgaagcaaaatct
gcagctattttattaaaaaaaaataaattttcttttgattatgcatatacatctgtatta
aaaagagcaatttatactttacgatatattttagatgaattaaatcaaaattggatttta
gtaaaaaaatcctggtgtttaaatgaaagacattatggagctttagaaggattaaataaa
gatgaagtaattaaaaaatatggagaaaaacaagttcttttatggagaagaagttttaat
attattccacctaaaattgatatacaagataaacgttttccaggaaacgacttacgttat
tctaatttaaatatttctgatattcctttaggtgaaagtttagaaatgacatcgaaaaga
gttattccttattggaaaacagttatctatcctcaattaaaaaataataaaaaaatactt
attgttgctcatgggaattctttacgtgctttaattcaatatttaaacaacatcacaaat
aaggacattataaaattaaatattccaactgctgtacctattgttttagagtttaatcaa
aataattctcttattcaatggtattacttaaaataa

DBGET integrated database retrieval system