KEGG   Buchnera aphidicola Ua (Uroleucon ambrosiae): BUAMB_288Help
Entry
BUAMB_288         CDS       T01830                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
buh  Buchnera aphidicola Ua (Uroleucon ambrosiae)
Pathway
buh00010  Glycolysis / Gluconeogenesis
buh00051  Fructose and mannose metabolism
buh00562  Inositol phosphate metabolism
buh01100  Metabolic pathways
buh01110  Biosynthesis of secondary metabolites
buh01120  Microbial metabolism in diverse environments
buh01130  Biosynthesis of antibiotics
buh01200  Carbon metabolism
buh01230  Biosynthesis of amino acids
Module
buh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:buh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUAMB_288 (tpiA)
   00051 Fructose and mannose metabolism
    BUAMB_288 (tpiA)
   00562 Inositol phosphate metabolism
    BUAMB_288 (tpiA)
Enzymes [BR:buh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BUAMB_288 (tpiA)
Exosome [BR:buh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BUAMB_288 (tpiA)
  Exosomal proteins of bladder cancer cells
   BUAMB_288 (tpiA)
  Exosomal proteins of melanoma cells
   BUAMB_288 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEO08104
UniProt: G2LPG7
Position
complement(326133..326945)
Genome map
AA seq 270 aa AA seqDB search
MNKFLIVANWKLNGSINMISSFFEYIKLHASIYLEKNVIVIAPPTIYLERVYRKIAKINI
FLGAQNVDINLKGAFTGETSITMLKEIGVKYVIVGHSERRLWHHENNDIISKKIYLIKKF
NLIPILCIGETKYDRDHGKTITIIKKQLDDIIAILGKLVFQNIVIAYEPIWAIGTGLAAD
PKNIQLIHKFIKNYVRIYDSSIKNILVQYGGSINQKNVKSFISQPDIDGLLIGSASLNAE
EFFKIIQISHNFLKNKISYYKYFYISNHLN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttttaattgtagctaactggaaattaaatggaagcataaatatgatttct
agtttttttgaatatataaaattacatgcatcaatttatttagaaaaaaatgttattgtt
attgctcctcctactatatatttagaacgagtttatagaaaaatagctaaaataaatatt
tttcttggtgctcaaaatgtagatattaatttaaaaggggcatttactggcgaaacttct
attacaatgcttaaagaaataggtgtaaaatatgttattgttggtcattctgaaagacgt
ttatggcatcatgaaaataatgatattatttcgaaaaaaatatatttaattaaaaaattt
aacttaatacctattttatgcataggtgaaacaaaatatgatagagatcatggtaagact
ataacaattataaaaaaacaattagatgatataatagcaatattaggaaaattagtattt
caaaatatagtgattgcttatgagcctatttgggctatcggaacaggtttagcagctgat
ccaaaaaatatacaattaatacataaatttataaaaaattatgttagaatttatgattca
tctattaaaaatatcttagtccaatatggaggttctattaatcaaaaaaatgtaaaatca
tttattagtcaaccagatatagatggtttattgattggtagtgcatctttaaatgctgaa
gaattttttaaaatcatacaaatttctcataattttttaaaaaataaaattagttattat
aaatatttttatatatccaaccacctaaattaa

DBGET integrated database retrieval system