KEGG   Buchnera aphidicola Ua: BUAMB_430Help
Entry
BUAMB_430         CDS       T01830                                 

Gene name
recD
Definition
exodeoxyribonuclease V 67 kDa polypeptide
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
buh  Buchnera aphidicola Ua
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:buh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480656..482464
Genome map
AA seq 602 aa AA seqDB search
MMNLLKKAVQKKIINQIDLDFSKFLDKKNNIIILVAACISYENRQGHIFLPIQYFEKNNF
FSSFNQKFINKILTILEKKINWEVELLKHSSCSNGSRPTPLVIHQKKIYLYKMWKSKNNI
LDYLSKHHTINKINKKKCLVILNNLFPNKKKDFQKISAATALLNKIVFIIGGPGTGKTTT
ILKIIIALIKSTNKIIKIQLSAPTGKATTRLFEMIKNNIFDIYLSEKEKQSILLTPKTIH
QLLKIHKISQKSILNKNNLLDLDVLIIDEISMVDVLMMEKILFSVSKKTKLIFIGDQNQL
RPIEPGSILRYIYYHIKYSYNAKNILNIEKITGYKLLNKIKKKIAILISNNICTLHKNYR
FNQNSGIYTLAHAVINQKIKIIKNACNNKIKNIFFYQINSIQKYNNMIEQISSKYTYFWK
IIQNQKNILNIIQAFQKHQTLCVLNDGLFGVNILNMKIEENMYHKKMIKYIDINKELWYI
GKPIMITKNNPYLNVFNGNIGIININHNGVVQASFLKENNTIHNIPVKILKNYKTAWVMT
IHKAQGSEFINTTLVLPNFYSSYLNQDIIYTGITRSQKTLNIFSKKDTFIKSVFNQTNQI
RY
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttattaaaaaaggctgtacaaaaaaaaattatcaatcaaattgatttagat
ttttcaaaatttcttgataaaaaaaataatataattattttagttgcagcgtgtataagt
tatgaaaatagacaagggcatatctttttacctattcaatattttgaaaaaaataatttt
ttttctagttttaatcaaaaatttataaacaaaatattaactattttagaaaaaaaaata
aattgggaagtagaattattaaaacattcatcttgtagcaatggttctagaccaacccct
ttagttattcatcaaaaaaagatatatctttataaaatgtggaaatctaaaaataatatt
ttagattatttatcaaaacatcataccataaacaaaattaacaaaaaaaaatgtttagtt
atattaaataatttatttcctaataagaaaaaagattttcaaaaaatatcagcagcaact
gctttattaaataaaattgtttttattattggaggacctggaactggtaaaactactact
atattaaaaataataattgctttaataaaaagtacaaacaaaataataaaaattcaatta
tctgcaccaacaggaaaagcaacaacacgtttatttgaaatgataaaaaataatattttt
gatatttatctctctgaaaaagagaaacaatcaattttattaactcctaaaacaatccat
caattattaaaaattcataaaatttcacaaaaaagtattttaaataaaaataatctatta
gatttagacgtattaattattgatgaaatttctatggtagatgttctaatgatggaaaaa
atattattttcagtatcaaaaaaaactaaattaatttttattggtgatcaaaatcaacta
cgtccaatagaaccaggatctatattaagatatatttattatcatattaagtatagttat
aatgctaaaaatatactaaatattgaaaaaattacaggttataaattattaaacaaaata
aaaaaaaaaatagcaatattaattagcaataatatatgtacattacacaaaaattataga
tttaatcaaaattctggcatttatacattagcgcatgcagttattaatcaaaaaattaaa
attattaaaaatgcttgtaataataaaataaaaaatatatttttttatcaaataaactct
attcaaaaatataataatatgattgaacaaatatcctcaaaatatacatatttttggaaa
atcatacagaatcaaaaaaatattttaaatataatacaagcttttcaaaaacatcaaaca
ttatgtgtattaaatgatggtttatttggtgttaatatcttaaatatgaaaattgaagaa
aatatgtatcataaaaaaatgataaaatatattgatattaataaagaattatggtatata
ggaaaaccaattatgataactaaaaataatccatatttaaacgtatttaatggaaatatt
ggaattattaatattaatcataatggtgttgtacaagcatcttttttaaaagaaaataat
actattcataatattccagtaaaaattttaaaaaattacaaaactgcttgggtgatgact
attcataaagctcaaggttcagaatttataaatactactttagtattgccaaatttttat
tcttcttatttaaatcaagatattatatatactggaattacaagatctcaaaaaacttta
aatatattttcaaaaaaagatacatttatcaaatctgtttttaatcaaacaaatcaaata
cgttattaa

DBGET integrated database retrieval system