KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0040Help
Entry
BurJV3_0040       CDS       T01596                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BurJV3_0040
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BurJV3_0040
Enzymes [BR:buj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BurJV3_0040
Lipid biosynthesis proteins [BR:buj01004]
 Desaturase
  First
   BurJV3_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
44645..45847
Genome map
AA seq 400 aa AA seqDB search
MPDALMSLLTGGVLGLGWWAMLVVLLVFTQITIFSVTLYLHRSQAHRGVDFHPALAHVFR
FWLWLTTSMITREWVAIHRKHHAKVETEDDPHSPVTRGIGKVFWHGVELYREARGMRADI
EQYGRGTPDDAIERHLYTPHATLGPVLLLVINSVLFGLPGVALWAIQMAWIPFWAAGVVN
GLGHWWGYRNYESADTSTNLTPWGFWIGGEELHNNHHAFPSSARFAMRRWEFDIGWSAIR
LLQALRLARVLRVAPAMDVRPNIAVPDAETLKALLSHRFQAMTDYQRNVFMPALREEAVQ
AGAKLRRLLPRRLRRGLVNDGRWLKPDSRAQLSAWVEQRPRIRTLVEYRGRLAALLEARG
HDAAERLHQLQAWCREAEESGIAALQAYAARLKGYSLVGA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgccctgatgtccctgttgaccggtggtgtgctcggcctgggctggtgggcc
atgctggtggtgttgctggtcttcacccagatcaccatcttctcggtgaccctgtacctg
caccgcagccaggcccatcgcggggtcgatttccacccggcgctggcccatgtgttccgc
ttctggctgtggctgaccacctcgatgatcacccgcgagtgggtggccatccaccgcaag
caccacgccaaggtggagaccgaggacgatccgcacagcccggttacccgcggcatcggc
aaggtgttctggcacggcgtggagctgtaccgcgaagcgcgcggcatgcgcgcggacatc
gagcagtacgggcgcggcaccccggacgacgcgatcgagcgccacctgtataccccgcac
gcgacgctggggccggtgctgctgctggtgatcaacagcgtgctgttcggactgcccggc
gtggccctgtgggcgatccagatggcgtggatcccgttctgggcggccggcgtggtcaat
ggcctgggccactggtggggctatcgcaactacgagtcggccgatacctccaccaacctc
acgccgtgggggttctggatcggtggcgaggagctgcacaacaaccatcatgccttcccc
agttcggcgcgcttcgcgatgcggcgctgggagttcgacatcggctggagtgcgatccgc
ctgctgcaggcgctgcgcctggccagggtgctgcgggtggcgccggccatggacgtgcgc
ccgaacatcgctgtgcccgatgccgagaccctgaaggcactgttgtcgcatcgcttccag
gcaatgaccgattaccagcgcaatgtgttcatgccggccctgcgcgaggaagccgtgcag
gccggggccaagctgcgccgcctgctgccgcgccggctgcgccggggcctggtcaacgac
ggccgctggctgaagccggacagccgtgcccagctcagcgcgtgggtggaacaacggccg
cgcatccgcaccctggtcgagtaccgcgggcgattggccgcgttgctggaagcccgtggt
cacgacgccgccgagcgcctgcatcagctgcaggcgtggtgccgcgaggccgaggaaagc
ggtatcgcggcgttgcaggcctatgccgcacgcttgaagggctacagcctggtgggcgcg
tga

DBGET integrated database retrieval system