KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0040Help
Entry
BurJV3_0040       CDS       T01596                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:buj01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:buj01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
44645..45847
Genome map
AA seq 400 aa AA seqDB search
MPDALMSLLTGGVLGLGWWAMLVVLLVFTQITIFSVTLYLHRSQAHRGVDFHPALAHVFR
FWLWLTTSMITREWVAIHRKHHAKVETEDDPHSPVTRGIGKVFWHGVELYREARGMRADI
EQYGRGTPDDAIERHLYTPHATLGPVLLLVINSVLFGLPGVALWAIQMAWIPFWAAGVVN
GLGHWWGYRNYESADTSTNLTPWGFWIGGEELHNNHHAFPSSARFAMRRWEFDIGWSAIR
LLQALRLARVLRVAPAMDVRPNIAVPDAETLKALLSHRFQAMTDYQRNVFMPALREEAVQ
AGAKLRRLLPRRLRRGLVNDGRWLKPDSRAQLSAWVEQRPRIRTLVEYRGRLAALLEARG
HDAAERLHQLQAWCREAEESGIAALQAYAARLKGYSLVGA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgccctgatgtccctgttgaccggtggtgtgctcggcctgggctggtgggcc
atgctggtggtgttgctggtcttcacccagatcaccatcttctcggtgaccctgtacctg
caccgcagccaggcccatcgcggggtcgatttccacccggcgctggcccatgtgttccgc
ttctggctgtggctgaccacctcgatgatcacccgcgagtgggtggccatccaccgcaag
caccacgccaaggtggagaccgaggacgatccgcacagcccggttacccgcggcatcggc
aaggtgttctggcacggcgtggagctgtaccgcgaagcgcgcggcatgcgcgcggacatc
gagcagtacgggcgcggcaccccggacgacgcgatcgagcgccacctgtataccccgcac
gcgacgctggggccggtgctgctgctggtgatcaacagcgtgctgttcggactgcccggc
gtggccctgtgggcgatccagatggcgtggatcccgttctgggcggccggcgtggtcaat
ggcctgggccactggtggggctatcgcaactacgagtcggccgatacctccaccaacctc
acgccgtgggggttctggatcggtggcgaggagctgcacaacaaccatcatgccttcccc
agttcggcgcgcttcgcgatgcggcgctgggagttcgacatcggctggagtgcgatccgc
ctgctgcaggcgctgcgcctggccagggtgctgcgggtggcgccggccatggacgtgcgc
ccgaacatcgctgtgcccgatgccgagaccctgaaggcactgttgtcgcatcgcttccag
gcaatgaccgattaccagcgcaatgtgttcatgccggccctgcgcgaggaagccgtgcag
gccggggccaagctgcgccgcctgctgccgcgccggctgcgccggggcctggtcaacgac
ggccgctggctgaagccggacagccgtgcccagctcagcgcgtgggtggaacaacggccg
cgcatccgcaccctggtcgagtaccgcgggcgattggccgcgttgctggaagcccgtggt
cacgacgccgccgagcgcctgcatcagctgcaggcgtggtgccgcgaggccgaggaaagc
ggtatcgcggcgttgcaggcctatgccgcacgcttgaagggctacagcctggtgggcgcg
tga

DBGET integrated database retrieval system