KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0152Help
Entry
BurJV3_0152       CDS       T01596                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BurJV3_0152
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BurJV3_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(173028..173429)
Genome map
AA seq 133 aa AA seqDB search
MRAPRLLIAFAVALLATACQRPPAEPATPEQAQQQAMQRAFELCAGCHTVQPGGIHRFGP
NLHGVIGRRAGSLPDYGYSDGMRRANITWTAQTLDTFLQSPTHLVPGTRMYNAFPSAERR
ALVIAYLQQQSAQ
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcccctcgcctgctcatcgcctttgccgtggccctgcttgccacggcctgccag
cgcccacctgcggagccggccacacccgaacaggcgcagcagcaggccatgcagcgcgcg
ttcgaactgtgtgccggctgccacaccgtgcagcccggtggcatccaccgcttcgggccg
aacctgcacggcgtgatcggccgccgcgccggcagcctgcccgactatggctactccgac
ggcatgcgccgcgccaacatcacctggaccgcgcagacgctggataccttcctgcagtca
cccacgcacctggtgccgggcacgcgcatgtacaacgccttccccagcgccgaacgccgc
gccctggtgatcgcctacctgcagcagcagtcggctcagtga

DBGET integrated database retrieval system