KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0184Help
Entry
BurJV3_0184       CDS       T01596                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BurJV3_0184
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BurJV3_0184
   00630 Glyoxylate and dicarboxylate metabolism
    BurJV3_0184
Enzymes [BR:buj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BurJV3_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
206395..208017
Genome map
AA seq 540 aa AA seqDB search
MSAVASAVPTPATKATPGIALATRVAGQDTLLPAPLLALLVSLHRAVEPGRQARLLARRE
RQAFFDQGGLPDFREDTATIRSGDWRVAPLPAALLDRRVEITGPTDPKMVINALNSGAKV
FMADFEDSTSPTWRNLLAGQQSLAAAVRGDLEYTALNGKHYRLRPYDEQAVLIVRPRGWH
LDEKHVRIDGQFIAGGLFDAAVFAFHNARTLQAKDRGPYFYLPKLQSMEEAALWETALSH
IEGMLGLPHGQIKVTVLIETLPAVFEMDEILHALRDRIVGLNCGRWDYIFSYLKTFRRHA
DRVLPERGQVTMTQPFLKAYSELLIQTCHRRGAHAMGGMAAQIPINNDAAANEQAMARVR
ADKLREVTAGHDGTWVAHPALIPVAMAIFDEHMPGANQHSVLRQDVRVGRDELIARPPGT
ITRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRSQLWQWLHTPGQQLDDG
TAIDLALLDATLAQLPARLGDTAALPGGARIGEAIALLGELSRSDELTDFLTLPAYARID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgtcgcttccgctgttcccacccccgccaccaaggccacccccggcatcgcc
ctggcgacccgcgtggccggccaggacaccctgctgccggcgccgctgctggccctgctg
gtgtcgctgcaccgcgcggtggaaccgggccggcaggcacggctgctggcgcgccgcgag
cgccaggcgttcttcgaccagggcggcctgccggacttccgcgaagacaccgccacgatc
cgcagcggcgactggcgtgttgccccgctgccggccgcgctgctggaccgccgcgtcgag
atcaccggcccgaccgacccgaagatggtcatcaacgcgctgaactccggcgccaaggtg
ttcatggccgactttgaggattcgacctcgccgacctggcgcaacctgctggccgggcag
cagtcgctggccgccgcggtgcgtggcgatctcgaatacaccgcactcaatggaaagcac
taccgcctgcgcccgtacgacgagcaggcggtgctgatcgtgcgcccgcgtggctggcac
ctggacgagaagcacgtgcgcatcgatggccagttcattgccggtggcctgttcgacgcg
gcggtgttcgccttccacaacgcccgcaccctgcaggcgaaggaccgcggcccgtacttc
tacctgccgaagctgcagagcatggaggaagcggcgctgtgggaaaccgcgctgtcgcac
atcgaaggcatgctcggcctgccgcacgggcagatcaaggtgaccgtgctgatcgaaacg
ctgccggcggtgttcgagatggacgagatcctgcacgcgctgcgtgatcgcatcgtcggc
ctgaactgtgggcgctgggactacatcttctcgtacctgaagaccttccgccgccacgcc
gaccgcgtgctgcccgagcgcggccaggtgaccatgacccagccgttcctgaaggcgtat
tcggagctgctgatccagacctgccatcgccgtggtgcgcatgcgatgggcggcatggcc
gcgcagattccgatcaacaacgatgccgccgccaacgaacaggcgatggcccgcgtgcgc
gccgacaagctgcgcgaagtgaccgctggccacgatggcacctgggtcgcgcatccggcg
ctgattccggtggcgatggcgatcttcgacgaacacatgcccggtgcgaaccagcacagc
gtgctgcgccaggatgtgcgcgtcggccgcgacgaactgatcgcacggccgcccggcacc
atcacccgcgccggcttcgaaggcaatgtggaagtctgcgtgcgctacctggcggcatgg
ctggatggcaacggctgcgtgccgatccaccacctgatggaggacgcggccaccgccgag
atcagccgcagccagctgtggcagtggctgcatacgccgggccagcagctggacgacggc
accgccatcgacctggccctgctggatgccacgctggcgcagctgccggcacggctgggt
gacaccgccgcgctgcccggtggcgcacgcatcggcgaggccatcgccctgctcggcgaa
ctgagccgcagcgacgaactgaccgatttcctgaccctgccggcctacgcgcgcatcgac
tga

DBGET integrated database retrieval system