KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0184Help
Entry
BurJV3_0184       CDS       T01596                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00620  Pyruvate metabolism
buj00630  Glyoxylate and dicarboxylate metabolism
buj01100  Metabolic pathways
buj01110  Biosynthesis of secondary metabolites
buj01120  Microbial metabolism in diverse environments
buj01200  Carbon metabolism
Module
buj_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BurJV3_0184
   00630 Glyoxylate and dicarboxylate metabolism
    BurJV3_0184
Enzymes [BR:buj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BurJV3_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEM49520
JGI: BurJV3_0184
UniProt: G0K4G6
Position
206395..208017
Genome map
AA seq 540 aa AA seqDB search
MSAVASAVPTPATKATPGIALATRVAGQDTLLPAPLLALLVSLHRAVEPGRQARLLARRE
RQAFFDQGGLPDFREDTATIRSGDWRVAPLPAALLDRRVEITGPTDPKMVINALNSGAKV
FMADFEDSTSPTWRNLLAGQQSLAAAVRGDLEYTALNGKHYRLRPYDEQAVLIVRPRGWH
LDEKHVRIDGQFIAGGLFDAAVFAFHNARTLQAKDRGPYFYLPKLQSMEEAALWETALSH
IEGMLGLPHGQIKVTVLIETLPAVFEMDEILHALRDRIVGLNCGRWDYIFSYLKTFRRHA
DRVLPERGQVTMTQPFLKAYSELLIQTCHRRGAHAMGGMAAQIPINNDAAANEQAMARVR
ADKLREVTAGHDGTWVAHPALIPVAMAIFDEHMPGANQHSVLRQDVRVGRDELIARPPGT
ITRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRSQLWQWLHTPGQQLDDG
TAIDLALLDATLAQLPARLGDTAALPGGARIGEAIALLGELSRSDELTDFLTLPAYARID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgtcgcttccgctgttcccacccccgccaccaaggccacccccggcatcgcc
ctggcgacccgcgtggccggccaggacaccctgctgccggcgccgctgctggccctgctg
gtgtcgctgcaccgcgcggtggaaccgggccggcaggcacggctgctggcgcgccgcgag
cgccaggcgttcttcgaccagggcggcctgccggacttccgcgaagacaccgccacgatc
cgcagcggcgactggcgtgttgccccgctgccggccgcgctgctggaccgccgcgtcgag
atcaccggcccgaccgacccgaagatggtcatcaacgcgctgaactccggcgccaaggtg
ttcatggccgactttgaggattcgacctcgccgacctggcgcaacctgctggccgggcag
cagtcgctggccgccgcggtgcgtggcgatctcgaatacaccgcactcaatggaaagcac
taccgcctgcgcccgtacgacgagcaggcggtgctgatcgtgcgcccgcgtggctggcac
ctggacgagaagcacgtgcgcatcgatggccagttcattgccggtggcctgttcgacgcg
gcggtgttcgccttccacaacgcccgcaccctgcaggcgaaggaccgcggcccgtacttc
tacctgccgaagctgcagagcatggaggaagcggcgctgtgggaaaccgcgctgtcgcac
atcgaaggcatgctcggcctgccgcacgggcagatcaaggtgaccgtgctgatcgaaacg
ctgccggcggtgttcgagatggacgagatcctgcacgcgctgcgtgatcgcatcgtcggc
ctgaactgtgggcgctgggactacatcttctcgtacctgaagaccttccgccgccacgcc
gaccgcgtgctgcccgagcgcggccaggtgaccatgacccagccgttcctgaaggcgtat
tcggagctgctgatccagacctgccatcgccgtggtgcgcatgcgatgggcggcatggcc
gcgcagattccgatcaacaacgatgccgccgccaacgaacaggcgatggcccgcgtgcgc
gccgacaagctgcgcgaagtgaccgctggccacgatggcacctgggtcgcgcatccggcg
ctgattccggtggcgatggcgatcttcgacgaacacatgcccggtgcgaaccagcacagc
gtgctgcgccaggatgtgcgcgtcggccgcgacgaactgatcgcacggccgcccggcacc
atcacccgcgccggcttcgaaggcaatgtggaagtctgcgtgcgctacctggcggcatgg
ctggatggcaacggctgcgtgccgatccaccacctgatggaggacgcggccaccgccgag
atcagccgcagccagctgtggcagtggctgcatacgccgggccagcagctggacgacggc
accgccatcgacctggccctgctggatgccacgctggcgcagctgccggcacggctgggt
gacaccgccgcgctgcccggtggcgcacgcatcggcgaggccatcgccctgctcggcgaa
ctgagccgcagcgacgaactgaccgatttcctgaccctgccggcctacgcgcgcatcgac
tga

DBGET integrated database retrieval system