KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0185Help
Entry
BurJV3_0185       CDS       T01596                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BurJV3_0185
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BurJV3_0185
Enzymes [BR:buj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BurJV3_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
208082..209383
Genome map
AA seq 433 aa AA seqDB search
MSKLPTAEQIQHDWDTNPRWEGIQRNYSAADVVRLRGTVHIEHSLARLGAEKLWASLHER
EFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVKR
INNTLLRADQLHHAEGKDDIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQ
LASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTLLVARTDAEAADLLTSDIDGN
DKPFATGERTVEGFYKTRNGLDQAISRGLAYAPYADLVWCETGKPDLEFARRFAEAIHAK
FPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGSYGYKFQFITLAGFHALNYGMFNLAHG
YARRQMSAFVELQEAEFEAAERGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALTGSTE
EEQFHGGRSERAA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcccactgccgaacagatccagcacgactgggataccaacccgcgttgg
gaaggcatccagcgcaactacagcgccgctgacgtggtgcgcctgcgcggcaccgtccac
atcgagcactcgctggcccgcctgggtgcggagaagctgtgggcgtcgctgcatgagcgc
gagttcgtcaacgcgctgggtgcattgaccggcaaccaggccatgcagcaggtcaaggcc
ggcctgaaggcgatctacctgtccggttggcaggtggcggccgatgccaacctggccggg
cagatgtacccggaccagtcgctctacccggccgattcggtgccggcggtggtcaagcgc
atcaacaacacgctgctgcgcgccgaccagctgcaccacgccgaaggcaaggacgacatc
gatttcctgcagccgatcgtggccgatgcggaagccggtttcggcggcgtgctcaatgcg
ttcgaactgatgaaggcgatgatcgaggccggtgccgccggcgtgcacttcgaagaccag
ctggcctcggtgaagaagtgcggccacatgggcggcaaggtgctggtgccgacccgcgag
gcgatcgagaagctcaacgccgcgcgcctggccgccgacgtgctgggcgttccgaccctg
ctggtggcacgtaccgatgccgaagccgcggatctgctgaccagcgacatcgatggcaat
gacaagccgttcgccaccggcgagcgcacggtggaaggcttctacaagacccgcaacggc
ctggaccaggcgatcagccgtggcttggcctacgcgccctacgccgacctggtgtggtgc
gagaccggcaagccggacctggagttcgcacgcaggttcgccgaggcgatccatgcgaag
ttcccgggcaagctgctggcctacaactgctcgcccagcttcaactggaagaagaacctg
gacgacgccaccattgccaagttccagcgcgaactgggcagctacggctacaagttccag
ttcatcaccctggccggcttccacgcgctgaactacggcatgttcaatctggcccacggc
tacgcacgccggcagatgagtgcattcgtggaactgcaggaagccgagttcgaagcggcc
gagcgcggcttcactgcggtcaagcaccagcgcgaggtcggtaccggctacttcgatgcg
gtgacccaggcgatccaacagggccagtcgtcgaccaccgcgctgaccggctcgaccgag
gaagaacagttccatggcgggcgcagcgaacgcgcggcgtga

DBGET integrated database retrieval system