KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0493Help
Entry
BurJV3_0493       CDS       T01596                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BurJV3_0493
Enzymes [BR:buj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BurJV3_0493
Peptidases [BR:buj01002]
 Cysteine Peptidases
  Family C44
   BurJV3_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
547002..548903
Genome map
AA seq 633 aa AA seqDB search
MSGVVGAWLPPAEDEQLLQQLAPMLRALQQRGRGRIGYWTDAEAGLALGHCRAPTDTPLQ
PLSSDCGRYVLCLDGRLYNRSDLQAQLRDLPRSCSDARLLLQAIVEWGVERALSRIEGAF
GFSVWDRESRVLWLARDPVGERPLYYGWYQGQFLFASELKALQAFAGFAPSIDQDALSLL
LRHDYVPAPHTIYRGIHKLVAGAMLRIDLSDHAAGCSSQAAQGGTRYWCARDAMQSALQE
PLQPAPSLEQATDQLEAVLQKAIASRMHSPLACGAFLSGGTDSSLVTAMMQAQSTLPIEA
WTVGFDDPGHDESDWASQVARHLGVQHHLHRMDARQGLDLLQRLPQVWCEPFADASQLPT
LLASELLGARKPVALTGDGGDELFFGHPSYGRALRNARLCGGLPDWVRDLARRSGNRMNV
ERGRLGGWRALVAEVAANDVEGHYLQRVTRWRQPAQVVLGAREPVTIFQQQDTALPAEAR
IQLLDFRMDLAEGILAKVDRAGMAAGVETRAPLLDMEVVRLAWRLPQHLKYHDGEHKRIL
KHLLARYLPEPLVYRPKRGFGPPMARWLAGPLRDWAEALLDPQLLRNQGCFDVARVRGIW
EAFLRGERKWHTHLWNVLMFQAWHQHWHGGRGR
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgtggtcggggcctggctgccgcccgccgaggacgagcagctgctgcagcag
ctggccccgatgctgcgcgccctgcagcagcgtgggcgtggccgcatcggctactggacc
gacgccgaggccgggctcgcgctgggccattgccgggcgccgaccgatacgccgttgcag
ccgctgagctcggactgcggtcgctacgtgctgtgcctggacgggcgcctgtacaaccgc
agcgacctgcaggcgcagctgcgcgatctgccccgcagctgcagcgatgcgcggctgctg
ctgcaggcgatcgtcgaatggggcgtggagcgggcactgtcccgtatcgaaggtgcgttc
ggcttcagtgtctgggaccgcgagtcgcgcgtgctgtggctggcccgtgatccggtgggc
gagcgaccgctgtattacggctggtaccagggccagttcctgttcgcctccgagttgaag
gcgctgcaggccttcgccggcttcgcgccgagcatcgaccaggatgcgctgagcctgctg
ctgcgccacgactatgtgccggcgccgcacaccatctaccgaggcatccacaagctggtg
gcgggcgcgatgctgcgcatcgatctcagcgaccatgccgcgggttgctccagccaggct
gcgcaggggggaacgcgctactggtgcgcacgcgacgcgatgcagagcgcactgcaggag
ccgctgcagccggcgccgagcctggaacaggccaccgaccagctcgaagcggtactgcag
aaggccatcgcttcacgcatgcactcgcccctggcgtgcggcgcgttcctgtccggcggc
accgactcctcgctggtgacggcgatgatgcaggcacaatcgaccctgccgatcgaagcg
tggacggtcggcttcgacgatccggggcatgacgagagcgactgggcgtcgcaggtcgcg
cgccacctgggcgtgcagcaccacctgcaccggatggacgcgcgccagggcctggacctg
ctgcagcgcctgccgcaggtctggtgcgagcccttcgccgacgcctcgcagctgccgacg
ttgctggccagtgaactgctgggggcgcgcaagccggttgcactgaccggtgacggtggc
gatgaactgttcttcggccaccccagctatggccgcgcgctgcgcaatgcgcgcctgtgt
ggtggcctgccggactgggtacgcgacctggcgcggcgcagcggcaaccgcatgaacgtc
gaacgtggccgcctcggtggctggcgcgcactggtggccgaggtggctgccaacgatgtg
gaaggtcattacctgcagcgcgtgacccgctggcggcaaccggcgcaggtggtgctgggt
gcgcgtgagccggtgacgatcttccagcagcaggacacggcgctgccggccgaggcgcgc
atccagctgttggatttccgcatggacctggccgagggcatcctggccaaggttgatcgc
gcgggcatggcggcgggcgttgaaacccgtgcgccgctgctggacatggaggtggtgcgc
cttgcctggcggctgccgcagcacctgaagtaccacgatggcgagcacaagcggattctg
aagcacctgctggcgcgctacctgccggaaccgctggtgtatcgccccaagcgcggtttc
ggtccgccgatggcgcgctggctggccggtccgttgcgcgactgggcggaggcgctgctg
gacccgcagctgctgcgcaaccagggctgcttcgatgtggcacgcgtgcgcggtatctgg
gaggcgttcctgcgtggggagcgcaagtggcacacgcacctgtggaacgtgctgatgttc
caggcgtggcaccagcactggcacggtggtcgcgggcgctga

DBGET integrated database retrieval system