KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0529Help
Entry
BurJV3_0529       CDS       T01596                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BurJV3_0529
   00030 Pentose phosphate pathway
    BurJV3_0529
   00051 Fructose and mannose metabolism
    BurJV3_0529
   00052 Galactose metabolism
    BurJV3_0529
   00500 Starch and sucrose metabolism
    BurJV3_0529
   00520 Amino sugar and nucleotide sugar metabolism
    BurJV3_0529
  Nucleotide metabolism
   00230 Purine metabolism
    BurJV3_0529
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BurJV3_0529
Enzymes [BR:buj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BurJV3_0529
    5.4.2.8  phosphomannomutase
     BurJV3_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(593816..595162)
Genome map
AA seq 448 aa AA seqDB search
MPLPAFKAYDIRGRVPEELNEDLARRIGTALNAQLAPGPVVLGHDVRLTSPALQDALAAG
LRGAGREVIDIGLCGTEEVYFQTDHLGAAGGVMVTASHNPMDYNGMKLVKENARPISSDT
GLFAISDAVAADSSAAQPPCAGQIAQHDKSAYIQHLLSYVDTSKLKPLQVVVNAGNGGAG
AIVDLLAPHLPFEFIRICHEPDGSFPNGIPNPLLPENRAATADAVREHGADFGIAWDGDF
DRCFFFDHNGRFIEGYYLVGLLAKAILAHHPGGKVVHDPRLVWNTVEMVEQAGGVPVLCK
SGHAFIKEKMRAEDAVYGGEMSAHHYFREFAYADSGMIPWLLIAQLVSESGRSLADWVED
RMAAYPCSGEINFKVADAKAAVARVMEHFAAQSPALDYTDGVSADFGDWRFNLRSSNTEP
LLRLNVESRGDAALMQARTDEISSLLQK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcccgccttcaaggcctatgacatccgcggccgtgtgccggaagaactgaac
gaagacctggcacgccggatcggcacggccttgaatgcacagctcgctccgggcccggtt
gtgctgggccacgacgtccgcctgaccagccccgcactgcaggacgcgctggcggccggc
ctgcgcggtgcaggccgcgaagtcatcgacatcggcctgtgtggcaccgaggaggtctat
ttccagaccgatcacctgggggctgccggcggggtgatggtcaccgccagccacaatccc
atggattacaacggcatgaagctggtcaaggagaacgcccggccgatcagctccgatacc
ggcctgttcgcgatctccgatgcggtcgccgccgattcatccgcggcacagccaccttgc
gccggccagatcgcccagcatgacaaaagcgcctacatccagcacctgctgagctacgtt
gacaccagcaagctcaagccactgcaagtcgttgtcaatgccggcaacggcggcgccggc
gccatcgtcgacctgctggcaccgcacctgccgttcgagttcatccgcatctgccacgaa
ccggacggcagcttccccaacggcattcccaatccactgttgccggaaaaccgcgccgcc
accgccgacgccgtgcgcgaacatggcgcggacttcggcattgcgtgggatggcgacttc
gaccgctgtttcttcttcgaccacaacggccgcttcatcgagggctactacctggtcggc
ctgctggccaaggcaatcctcgcccaccatccgggtggcaaggtcgtgcatgacccccgc
ctggtctggaacaccgtggagatggtcgaacaggccggtggcgtgccagtgctgtgcaag
agtggccacgccttcatcaaggaaaagatgcgcgcggaggatgccgtgtacggcggcgag
atgagcgcccaccactacttccgcgagttcgcgtatgccgactcgggcatgatcccgtgg
ctgctgatcgcccagctggtctccgaaagcggccgctcgctggccgactgggttgaagac
cgcatggccgcctatccttgcagcggtgagatcaacttcaaggttgccgatgccaaggct
gcggtcgcacgcgtgatggaacacttcgccgcgcaatcgcccgcgctggactacaccgat
ggcgtcagcgccgatttcggcgactggcgcttcaacctgcgcagctccaacactgaaccg
ctgctgcgcctgaatgtggaatcgcggggagacgctgcattgatgcaggcgcgcaccgac
gagatttcctccctgctgcagaaataa

DBGET integrated database retrieval system