KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0554Help
Entry
BurJV3_0554       CDS       T01596                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
619949..620734
Genome map
AA seq 261 aa AA seqDB search
MLRFAIAAVFGALSLTACAQPAPPAAKAPAAAAAKASPAANGSADQAVRAALTALNPGFQ
VDYIGAAPFPGFREVVVSGQLLYVSDDGRYLFQSQPYDIRAKGPANSEGLLGYRRGLLAK
ANHGDRIVFAAPNAKYTISVFTDIECGYCRKLHQDIAELNRNGITVEYLAFPRMGLGSKD
YTDMISVWCAADRRQALTNAKRGGSVPAKNCTNPVAMQYALGQQLGVNGTPAIFAPDGTQ
LGGYLPPAQLRAALDKLSGKR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctccgatttgccatcgccgccgtgttcggtgcgctcagcctgaccgcctgcgcccag
ccggccccgccggccgccaaggcgcctgccgcggctgcggccaaggccagcccggccgcc
aacggttcggccgaccaggccgtgcgcgccgcgctgaccgcgctgaatcccggcttccag
gtggactacatcggtgccgcgccgttccccggcttccgcgaagtggtggtctccggccag
ctgctgtacgtgtccgatgacggtcgctacctgttccagtcgcagccctacgacatccgc
gccaagggcccggccaacagtgaaggcctgctcggttaccgtcgcggcctgctggccaag
gccaaccacggcgatcgcatcgtgttcgccgcgccgaacgccaagtacaccatcagcgtg
ttcaccgacatcgagtgtggttactgccgcaagctgcaccaggacatcgccgagctcaac
cgcaacggcatcaccgtcgagtacctggcgttcccgcgcatgggcctgggcagcaaggac
tacaccgatatgatttcggtctggtgtgcagcggatcgtcgccaggccctgaccaacgcc
aagcgcggtggcagtgtgccggccaagaactgcaccaacccggtggcgatgcagtacgcg
ctgggccagcagctgggcgtgaatggcacgccggcgatcttcgcgccggatggcacccag
ctgggcggttacctgccgccagcgcagctgcgcgcggcgctggacaagctgtccgggaag
cgctga

DBGET integrated database retrieval system