KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0616Help
Entry
BurJV3_0616       CDS       T01596                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BurJV3_0616
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BurJV3_0616
Enzymes [BR:buj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BurJV3_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
703728..705236
Genome map
AA seq 502 aa AA seqDB search
MSPSMLLSQLLPDVALAGHDPVLTGLVLDSRAVRPGNAFVAIAGFGAHGLGFVEQARAAG
ASAILFEPPAPAELPAPADAIAVPGLRARMGAMADQFHGAPSRAMAMVGVTGTNGKTSTV
QLLAQAWHLLGTPSGSIGTLGAGLYGAVEPTGFTTPLVLQMHALLAQLRDAGARAVAMEV
SSHALDQGRVDAVHYDVAVFTNLTRDHLDYHGDMASYGAAKARLFHRPGLKAAVINLDDA
FGRQLFAGLPAGVQPIGLSSRGASDASVRAEALQLDGRGIAFELVIDGQRAAVQSPLLGR
FNVDNLLAVAGTLHAQGQPLPRIAEVLSALQPIRGRMNRLGGEDGLPTVVVDYAHTPDAL
EQALDSLHGHLHGALFCVFGCGGERDTGKRPQMAAIAERLANQVIVTDDNPRGEDGDVIV
ADILAGFQNADAVTVQRSRARAIGLAVKRAGAGDIILIAGKGHEPYQEVNGVRHDFDDTE
VAAAALAAKAGVLATQAGEGIA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtccttcgatgttgctttcgcagttgcttccggacgtggccctggcagggcacgac
cccgttctgaccggcctggtgctggacagccgtgccgtgcgccccggtaatgccttcgtc
gccatcgccggtttcggcgcgcatggcctgggctttgtcgagcaggcccgcgccgccggt
gccagcgccatcctgttcgaaccgccggcaccggctgagctgccggcaccggccgatgcg
atcgccgtgccgggcctgcgtgcgcgcatgggcgcgatggccgaccagttccatggcgca
ccgtcgcgggcgatggcgatggtcggcgtgaccggcaccaacggcaagacctccaccgtg
cagctgctggcccaggcctggcacctgctcggaacgcccagtggcagtatcggcacgttg
ggcgccggactttatggcgcggtcgaaccgaccggcttcaccacgccgctggtgctgcag
atgcatgcgctgctggcgcagctgcgcgacgccggcgcacgcgcggtggcaatggaagtc
agctcgcatgcgctggaccagggccgcgtggatgccgtgcactacgacgtggcggtgttc
accaacctcacccgcgaccatctggactaccacggtgacatggccagctacggcgcggcc
aaggcgcggctgttccatcgcccgggcctgaaggccgcggtgatcaatcttgacgacgcc
ttcggtcgccagctgttcgctggcctgccggccggcgtgcagccgatcggcctgagctcg
cgcggtgccagcgacgccagcgtgcgcgccgaggcgctgcagctggacggccgtggcatc
gccttcgagctggtcatcgacggccagcgtgcggcggtgcagtcgccgctgctgggccgc
ttcaacgtggacaacctgctggccgtggcgggaaccctgcatgcgcagggccagccgctg
ccgcgcattgccgaggtgctgtcggcgctgcagccgatccgtggccgcatgaaccgcctg
ggcggcgaagatggcctgccgaccgtggtggtcgattacgcgcatacgccggacgcgctg
gaacaggcgctggacagcctgcatggccacctgcacggtgcgctgttctgcgtgttcggc
tgcggtggcgagcgcgataccggcaagcgcccgcagatggcggcgattgccgagcgcctg
gccaaccaggtcatcgtcaccgacgacaacccgcgtggcgaagatggcgacgtgatcgtg
gccgacatcctggccggcttccagaacgccgatgctgtgaccgtgcagcgcagccgcgcg
cgcgcgatcggcctggcggtgaagcgtgccggtgccggcgacatcatcctgatcgccggc
aagggccacgagccgtaccaggaagtgaatggcgtgcgccatgacttcgacgacaccgaa
gtggctgcggcggcgttggctgccaaggctggcgtgttggccacgcaggccggggagggc
atcgcatga

DBGET integrated database retrieval system