KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0652Help
Entry
BurJV3_0652       CDS       T01596                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BurJV3_0652
Enzymes [BR:buj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BurJV3_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(748076..749041)
Genome map
AA seq 321 aa AA seqDB search
MSSSVVVVGSFNVDHVWRCESLPAPGATIAGRYSTGPGGKGFNQAVAACRAGADTHFVCA
LGDDAGGATARELAAQDGFALIAEASSEPTGTAGIYVDARGRNTIVIGPGANAALSTDFL
QQQQALLTAAKVVLVQLESPVPTIEAALATAREAGVTTVLNTAPADAPSTIGLLKLADVI
TPNETEFAALLGRHVGERVEANDVAALDGASLHALCRKLVGNGTVVVTLGSVGVFVSHAD
ENLRGDTQPYYRVGAEQVQAIDTTGAGDAFNGALAASLAQVADAPFARHVRFANQFAGRS
TEKEGAAAAMPRFTPADSEAK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagtgtcgttgtcgtcggttccttcaatgtcgatcacgtgtggcggtgcgag
tcgctgccggcaccgggtgcgaccattgccggccgttacagcaccggccccggtggcaag
ggcttcaaccaggccgtggccgcctgccgcgccggcgccgacacccacttcgtgtgcgcg
ttgggcgatgacgccggtggcgccaccgcgcgcgaactggccgcacaggatggcttcgcg
ctgatcgccgaggccagcagcgagccgaccggcaccgcaggcatctacgtcgatgcccgt
ggccgcaacaccatcgtgatcggcccgggcgccaatgccgcgctgagcaccgacttcctg
caacagcagcaggccctgctgacggccgccaaggtggtgctggtgcagctggaatcgccg
gtaccgaccatcgaagcggcgctggccacggcccgcgaagccggtgtcaccacggtgctc
aacaccgcaccggccgacgcaccctcgaccatcggcctgctcaagctggccgatgtgatc
accccgaacgagaccgagttcgccgccctgctcggccgccatgtcggcgagcgcgtggaa
gccaacgacgtcgccgcgctggatggcgccagcctgcacgcgctgtgccgcaagctggtc
ggcaacggtaccgtggtggtgaccctgggttcggtgggcgtgttcgtgtcgcatgccgat
gagaacctgcgcggcgatacccagccgtactaccgcgtgggtgccgaacaggtgcaggcg
atcgacaccaccggtgccggtgatgccttcaacggtgcgctggccgcatcgctggcgcag
gtggccgacgccccgttcgcccgccacgtgcgcttcgccaaccagttcgccggccgttcg
accgagaaggaaggcgccgctgcggcgatgccgcgcttcactccggccgattccgaagca
aagtag

DBGET integrated database retrieval system