KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0676Help
Entry
BurJV3_0676       CDS       T01596                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:buj00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:buj00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
773258..773749
Genome map
AA seq 163 aa AA seqDB search
MKLSMIVALDRNRGIGQGNAMPWHLPDDFKHFKALTLGKPILMGRKTAESIGRVLPGRTN
LVLTRSGQVPFEGMRAVASLDEAKAIAEGEGTSELCIIGGGEIFRQLLDQASDLYLTWVD
AEVPADTHFPEVDAQDWQEVSSEPHPADERHAYAFRFVHYVRR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctcgatgatcgtggcgctggaccgcaaccgcggcatcggccagggcaatgcc
atgccctggcacctgccggatgatttcaagcacttcaaggcgctgaccctcggcaagccg
atcctgatggggcgcaagaccgccgaatcgatcggccgcgtgctgccggggcggaccaac
ctggtgctgacccgcagcggccaggtgccgttcgagggcatgcgcgcggtggcgtcgctg
gacgaggcgaaggcgattgccgaaggcgagggcaccagcgagctgtgcatcatcggcggc
ggcgagatcttccgccagctgctcgaccaggccagtgacctgtacctgacctgggtggat
gccgaagtgcccgccgatacgcatttccccgaagtggatgcgcaggactggcaggaagtg
agcagcgagccgcacccggccgacgaacgccacgcgtacgcgttccgcttcgtgcactac
gtgcgccgctga

DBGET integrated database retrieval system