KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0735Help
Entry
BurJV3_0735       CDS       T01596                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:buj00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
831222..832091
Genome map
AA seq 289 aa AA seqDB search
MSGAVDDAGWSWWPAPAKLNLFLHITGRRADGYHELQTVFRLLDWGDRIGLRLREDGLVR
RQGEGLAGVAEADDLAVRAARLLKEVANVAQGADIIVEKHVSAGGGFGGGSSDAATVLVV
LNRLWQAGLDEDALAALGLRLGADVPVFVRGRNAWAEGVGERLQPIVLEPAWYVVVEPGV
HVPTPALFADPDLTRDSPVAKIEDFASGTLVGNAFEPVLRRREPAVEAALAALSDIGAAR
LTGSGSGCFVEFASQAAAEQGRSKLPKELRARVAAGVARSPLLDALEQH
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggcagtcgacgacgcgggctggtcctggtggccggccccggccaagctgaac
ctgttcctgcacatcaccggccgccgggccgacggctaccacgagctgcagaccgtgttc
cgcctgctggactggggggaccgcatcggcctgcgcctgcgtgaagacggcctggtgcgt
cggcagggcgagggcctggccggcgtggccgaggctgatgacctggcggtccgcgccgcg
cgcctgctcaaagaagtggcgaatgtcgcgcaaggcgcggacatcatcgttgaaaagcat
gtatctgccggtggcggcttcgggggcggttcgtccgacgcggccaccgtgctggtggtg
ctgaaccgactctggcaggcgggcctggacgaagacgcgctggctgcgctgggcctgcgc
ctgggcgccgacgtgccggtgttcgtgcgtggccgcaatgcctgggccgaaggggtgggc
gagcgcctgcagccgatcgtgctggaaccggcgtggtatgtggtggtcgaaccgggcgtt
catgttcccacccccgccctgtttgcagacccggatttgacgcgcgacagcccagtggcg
aaaatagaggacttcgcttccgggaccctggtcgggaacgcgttcgaaccggtgctgcgc
cgccgtgagcctgccgtcgaagcagcgcttgccgcgttgagcgacatcggcgcggcgcgg
ctgaccgggtcgggaagtggttgtttcgtcgagttcgcatcgcaggctgctgcagagcag
ggacggtcgaagttgccgaaggagttgcgggcaagggtggcagcgggcgttgcgcgttcg
ccactgctggatgcactcgagcaacactga

DBGET integrated database retrieval system