KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0879Help
Entry
BurJV3_0879       CDS       T01596                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:buj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BurJV3_0879
DNA repair and recombination proteins [BR:buj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BurJV3_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1000482..1001081
Genome map
AA seq 199 aa AA seqDB search
MSAPLLEQLIDALRVLPGVGQKTAQRMAYHLLEREREGGQRLAETLALAVERIGHCAQCR
DFSETELCPTCANNSRERSQLCVVESPADRLAIENATGFRGVYFVLQGRLSPLDGIGPRE
LGLEQLEQRLAEGEVQELIIATSATVEGEATAHYLAQLARARKVQPSRLAQGLPLGGELE
YVDRGTLSHAFGTRSEFRD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcacccctgcttgaacaattgatcgacgcactgcgggtgctgcctggcgtcggc
cagaagaccgcgcagcgcatggcttaccacctgctcgagcgcgagcgcgaaggtggccag
cggctggccgaaaccctggcgctggcggtggagcgcatcggccactgcgcgcaatgccgc
gacttcagcgaaaccgagctgtgcccgacctgtgccaacaacagccgcgagcgcagccag
ctgtgcgtggtcgaatcgccggccgaccgcctggcgatcgagaacgcgaccggcttccgc
ggtgtctacttcgtgctgcagggccggctgtcgccgctcgatggcatcggcccgcgcgag
ctgggcctggagcagctggagcagcggctggccgaaggcgaggtgcaggagctgatcatc
gccaccagtgccaccgtcgaaggcgaagccaccgcgcactacctggcgcagctggcgcgc
gcgcgcaaggtgcagcccagccggctggcgcagggcctgccgctcggtggcgaactcgaa
tatgttgaccgcggcacgctgtcacacgcgttcggcacgcgcagcgaattccgcgactga

DBGET integrated database retrieval system