KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0938Help
Entry
BurJV3_0938       CDS       T01596                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BurJV3_0938
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BurJV3_0938
Enzymes [BR:buj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BurJV3_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1059288..1060238
Genome map
AA seq 316 aa AA seqDB search
MTAQQIDASGRLRHLLTLEGLPRETLLQLLDRAGQIRDAAVGRVGNKRHVLAGSAVCTLF
FEPSTRTRSSFQLAAQRLGADVLNFDASTSSTRKGETACDTLRNLEAMGVRGFVVRHPDD
GAVAALAEAAGEGTALINAGDGRSSHPTQGLLDMLTLRQAKGPDFSKLKVVIVGDVKHSR
VARTDLHALRTLGVGEIRVCGPQSLLPDDETLKGCVVGDDFDAMLEGVDALMMLRLQRER
MEEGLVPSLEQYHAQYGLTNERLARAGKDAAVLHPGPINRGVEVTDEVADGPQSWVLRQV
ANGVAVRMAVLETLLG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagcaaatcgatgcctccggacgcctgcgccacctgctgaccctcgagggc
ctgccgcgcgaaaccctgctgcagctgctcgaccgggcggggcagatccgcgacgctgcg
gtcggccgcgtcggcaacaagcgccatgtgctggccggttcggcggtatgcacgctgttc
ttcgaaccgtccacgcgcacccgcagctcgttccagctggccgcgcagcgcctgggcgcc
gacgtgctcaacttcgatgcctcgacctcgtccacgcgcaagggcgaaaccgcctgcgac
acgctgcgcaacctggaagcgatgggcgtgcgcggcttcgtggtgcgccaccccgatgat
ggcgcggtggccgcgctggccgaagcggcgggcgagggcaccgcgctgatcaatgccggc
gacggccgcagctcgcacccgacccagggcctgctggacatgctgaccctgcgccaggcc
aagggcccggacttctcgaagctgaaagtggtgatcgtcggcgacgtgaagcactcgcgc
gtggcccgcaccgacctgcatgcgctgcgcacgctgggcgtgggcgagatccgcgtgtgc
ggcccgcagtcgctgctgccggacgacgagaccctgaagggctgcgtggtcggcgatgat
ttcgacgcgatgctggaaggcgtcgacgcgctgatgatgctgcgcctgcagcgcgagcgc
atggaggaaggcctggtgccgtcgctggagcagtaccacgcccagtacggtctgaccaac
gaacgcctggcgcgcgccggcaaggatgccgcggtgctgcacccgggcccgatcaatcgc
ggcgtggaagtcaccgacgaggtggctgacggcccgcagtcgtgggtgctgcgccaggtc
gccaacggcgtcgccgtgcgcatggccgtgctggaaaccctgttgggctga

DBGET integrated database retrieval system