KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0938Help
Entry
BurJV3_0938       CDS       T01596                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:buj00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:buj00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1059288..1060238
Genome map
AA seq 316 aa AA seqDB search
MTAQQIDASGRLRHLLTLEGLPRETLLQLLDRAGQIRDAAVGRVGNKRHVLAGSAVCTLF
FEPSTRTRSSFQLAAQRLGADVLNFDASTSSTRKGETACDTLRNLEAMGVRGFVVRHPDD
GAVAALAEAAGEGTALINAGDGRSSHPTQGLLDMLTLRQAKGPDFSKLKVVIVGDVKHSR
VARTDLHALRTLGVGEIRVCGPQSLLPDDETLKGCVVGDDFDAMLEGVDALMMLRLQRER
MEEGLVPSLEQYHAQYGLTNERLARAGKDAAVLHPGPINRGVEVTDEVADGPQSWVLRQV
ANGVAVRMAVLETLLG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagcaaatcgatgcctccggacgcctgcgccacctgctgaccctcgagggc
ctgccgcgcgaaaccctgctgcagctgctcgaccgggcggggcagatccgcgacgctgcg
gtcggccgcgtcggcaacaagcgccatgtgctggccggttcggcggtatgcacgctgttc
ttcgaaccgtccacgcgcacccgcagctcgttccagctggccgcgcagcgcctgggcgcc
gacgtgctcaacttcgatgcctcgacctcgtccacgcgcaagggcgaaaccgcctgcgac
acgctgcgcaacctggaagcgatgggcgtgcgcggcttcgtggtgcgccaccccgatgat
ggcgcggtggccgcgctggccgaagcggcgggcgagggcaccgcgctgatcaatgccggc
gacggccgcagctcgcacccgacccagggcctgctggacatgctgaccctgcgccaggcc
aagggcccggacttctcgaagctgaaagtggtgatcgtcggcgacgtgaagcactcgcgc
gtggcccgcaccgacctgcatgcgctgcgcacgctgggcgtgggcgagatccgcgtgtgc
ggcccgcagtcgctgctgccggacgacgagaccctgaagggctgcgtggtcggcgatgat
ttcgacgcgatgctggaaggcgtcgacgcgctgatgatgctgcgcctgcagcgcgagcgc
atggaggaaggcctggtgccgtcgctggagcagtaccacgcccagtacggtctgaccaac
gaacgcctggcgcgcgccggcaaggatgccgcggtgctgcacccgggcccgatcaatcgc
ggcgtggaagtcaccgacgaggtggctgacggcccgcagtcgtgggtgctgcgccaggtc
gccaacggcgtcgccgtgcgcatggccgtgctggaaaccctgttgggctga

DBGET integrated database retrieval system