KEGG   Stenotrophomonas maltophilia JV3: BurJV3_0957Help
Entry
BurJV3_0957       CDS       T01596                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00520  Amino sugar and nucleotide sugar metabolism
buj00550  Peptidoglycan biosynthesis
buj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BurJV3_0957
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BurJV3_0957
Enzymes [BR:buj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BurJV3_0957
Peptidoglycan biosynthesis and degradation proteins [BR:buj01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BurJV3_0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AEM50291
JGI: BurJV3_0957
UniProt: G0K0X3
Position
1074718..1075989
Genome map
AA seq 423 aa AA seqDB search
MAKIVVTGGAALHGEVSISGAKNAVLPILCATLLADAPVEITNVPHLHDVVTTVKLLGEL
GAKVTIDQGTLSRGSAIVVDPRSVNQHVAPYELVKTMRASILVLGPLLARFGAAEVSLPG
GCAIGSRPVDQHIKGLQALGAEIVVENGFIKATAKRLKGGHFTFDMVSVTGTENVLMGAV
LAEGTTILDNCAMEPEVTDLAHCLIALGAKIEGLGTARLVIEGVERLSGGRHEVLPDRIE
TGTFLVAAAMTGGKVTVNRARPNTMDAVLSKLVEAGAKIETTDDTITLDMQGKRPKAVNL
TTAPYPAFPTDMQAQFMALNCVADGVGVINETIFENRFMHVNELLRLGADIQVEGHTAIV
RGSEHLSGAPVMATDLRASASLILAGLMASGETTIDRIYHLDRGYENIEEKLSSLGATIR
RVP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcgttgtgaccggcggcgctgcgctgcacggtgaagtgagcatctccggc
gccaagaacgccgtcctccccattctctgcgcgaccctgctggccgatgcgccggtggag
atcaccaacgtgccgcacctgcacgacgtggtcaccacggtgaagctgctgggcgagctg
ggcgccaaggtcaccatcgaccagggcacgctgtcgcgcggcagcgcgatcgtggtcgac
ccgcgctcggtcaaccagcacgtggcgccgtacgagctggtaaagaccatgcgcgcctcg
atcctggtgctgggcccgctgctggcccgcttcggcgcggcggaagtgtcgctgcccggc
ggctgcgcgatcggttcgcgtccggtcgaccagcacatcaagggcctgcaggcgctcggt
gccgagatcgtggtcgagaacggtttcatcaaggccaccgccaagcgcctgaagggcggt
catttcaccttcgacatggtcagcgtcaccggcaccgagaacgtgctgatgggcgcggtg
ctggctgaaggcaccaccatcctcgacaactgtgcgatggaaccggaagtgaccgatctg
gcgcattgcctgatcgcgctgggcgcgaagatcgaaggcctgggcactgcccgcctggtc
atcgaaggcgtcgagcgcctgtccggtggccgccatgaagtgcttcccgaccgcatcgag
accggcaccttcctggtggccgcggcgatgaccggcggcaaggtcacggtcaaccgtgcg
cggccgaacaccatggacgcggtgctgtccaagctggtcgaagccggtgcgaagatcgag
accaccgacgacaccatcaccctggacatgcagggcaagcggccgaaggcggtcaacctg
accaccgcgccgtacccggcgttcccgaccgacatgcaggcgcagttcatggcgctcaac
tgcgtggccgacggcgtcggcgtgatcaacgaaacgatcttcgagaaccgtttcatgcac
gtcaacgaactgctgcgcctgggcgcggacatccaggttgaaggccacaccgccatcgtg
cgtggcagcgaacacctgagcggtgcgccggtaatggccaccgacctgcgtgcctcggcc
tcgctgatcctggccggcctgatggccagcggcgagaccaccatcgaccgcatctaccac
cttgatcgtggctacgagaacatcgaagagaagctgtcttcgctcggcgccaccatccgg
cgcgtgccatga

DBGET integrated database retrieval system