KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1176Help
Entry
BurJV3_1176       CDS       T01596                                 

Definition
alpha/beta hydrolase fold domain-containing protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Brite
Enzymes [BR:buj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BurJV3_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1321544..1322380)
Genome map
AA seq 278 aa AA seqDB search
MTESHDFFLPGGPQGVLLVHGLTGTPAEMRMLGRGLNNAGFTVHGVQLPGHCGTVDDLLA
TTWEQWYQGVEDAAASLRGKVDQLFVGGLSMGAVLSLALAARRPEWVSGVGVYGATFRYD
GWNIPAVARLSFLLPWFKRFNIGRDRMFMEEPPYGLRDERLRAQVSAAMLSGDSAAAGLP
GNPWHALAEMRALSIWTRRHLHQVTAPCLVMHAREDDVASMGNAELVMSRVSGPKELVVL
EDSYHMITIDRERRDVIRRSARFFTEIGERSGVLKAVA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaatcgcacgacttcttcctccccggtggcccgcagggcgtgctgctggtccac
ggcctgaccggcaccccggcggaaatgcgcatgctgggcaggggcctgaacaacgccggt
ttcaccgtgcacggcgtgcagctgcccggccattgcggcaccgtggatgacctgctggcg
accacctgggaacagtggtaccagggcgtggaagatgcggcggcgagcctgcgtggcaag
gtcgaccagctgttcgtcggtggtctgtcgatgggcgcggtactgtcgctggcgctggct
gcacgccgccccgagtgggtgtccggcgtcggcgtgtatggcgccaccttccgctacgac
ggctggaacattcccgccgtggcccgcctgtcattcctgctgccgtggttcaagcgcttc
aacatcggccgcgaccgcatgttcatggaagaaccgccctacggcctgcgtgacgagcgc
ctgcgcgcgcaggtcagcgccgccatgctgtccggcgacagcgccgctgccggcctgccg
ggcaatccctggcacgcgctggccgagatgcgtgccctgagcatctggacccgtcgccac
ctgcatcaggtcaccgcgccgtgcctggtgatgcacgcccgcgaagacgatgtggccagc
atgggcaatgccgagctggtgatgtcgcgggtcagcggcccgaaggaactggtggtgctg
gaagacagctaccacatgatcaccatcgaccgcgaacgccgcgacgtgatccgccgcagc
gcgcgcttcttcaccgaaatcggtgaacgcagcggcgtcctcaaggcggtggcctga

DBGET integrated database retrieval system