KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1186Help
Entry
BurJV3_1186       CDS       T01596                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00010  Glycolysis / Gluconeogenesis
buj00260  Glycine, serine and threonine metabolism
buj00680  Methane metabolism
buj01100  Metabolic pathways
buj01110  Biosynthesis of secondary metabolites
buj01120  Microbial metabolism in diverse environments
buj01130  Biosynthesis of antibiotics
buj01200  Carbon metabolism
buj01230  Biosynthesis of amino acids
Module
buj_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BurJV3_1186
  Energy metabolism
   00680 Methane metabolism
    BurJV3_1186
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BurJV3_1186
Enzymes [BR:buj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BurJV3_1186
Membrane trafficking [BR:buj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BurJV3_1186
Exosome [BR:buj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BurJV3_1186
  Exosomal proteins of melanoma cells
   BurJV3_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEM50518
JGI: BurJV3_1186
UniProt: G0K335
Position
1333533..1334282
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRREAAAAGRLMREEGLQFDVAHTSVLK
RAIHTLQGALAELEQDWLPVNKSWRLNERHYGGLQGLDKAETAAKHGEEQVKVWRRSYDI
PPPPMDLEDPGHPIHDRRYAGLDRNALPGTESLATTLDRVLPYWHDAIAPQLKDGKTVLV
TAHGNSLRALYKYLNNVSREEILELNIPTGIPLLFELNDDLTVQSFRYLGDPEAARKAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtaaactcgtactgttgcgccatggccagagccagtggaacctggacaatcgc
ttcaccggctgggtcgatgtcgacctgaccgagcaggggcgccgggaagcggccgctgcg
ggtcgcctgatgcgcgaggaaggcctgcagttcgacgtcgcccacacctccgtgctcaag
cgcgccatccacaccctgcagggtgcactggccgagctggagcaggactggctgccggtg
aacaagtcctggcgcctcaacgaacgccattacggcggcctgcagggcctggacaaggcc
gagaccgctgccaagcacggcgaggagcaggtcaaggtgtggcgtcgttcctacgacatc
ccgccgccgccgatggatctggaagatccgggccacccgatccatgaccgccgctacgcc
ggcctggaccgcaacgcgctgccgggcaccgaatcgctggcgaccacgctggaccgcgtg
ctgccttactggcacgacgccatcgcgccacagctgaaggacggcaagaccgtgctggtc
accgcccatggcaattcgctgcgcgcgctgtacaagtacctcaacaacgtctcgcgcgag
gaaatcctcgagctgaacatcccgaccggcatcccgctgctgttcgaactgaacgacgac
ctgacggtgcagtcgttccgctacctgggcgacccggaagcggcgcgcaaggccgctgaa
gctgtagccaaccagggcaaggcgaagtaa

DBGET integrated database retrieval system