KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1206Help
Entry
BurJV3_1206       CDS       T01596                                 

Definition
phosphodiesterase I (EC:3.1.4.1)
Organism
buj  Stenotrophomonas maltophilia JV3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1357728..1358978)
Genome map
AA seq 416 aa AA seqDB search
MTSVRLTCSLALLLPLAACTTAPAPTASVPTSVAAATPPKLLLISIDGLRADALDRGLTP
NLQRMIDGGVRARWMTPSYPSLTFPNHYTIVTGLRPDHHGIVNNSMDDAALGRFELGNRE
AVTDSRWWGGEPIWVGAENAGVRTATTSWPGSESEIQGVRPSQWRVYDGKEPLEQRAGIV
LDWLAQTDADAPRLTTLYMEHVDKAGHNYGPGSKQYADAIVRADLIVGQVLDGLQQRGLA
ATTNVIVVSDHGMASVPESQVISTESMVDPAIARNVSQGQSVGFAPVAGREAEAERALLG
RHAHYECWKKENLPARWHYGTHPRIPAIICNMDEGWDALHQQKLAKRVHQDRGSHGYDNA
LPSMRAVFVASGPSFRQGLVIDGFDNVDVYPLLAHLLQVPAAPNDGNAETLKKTLR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgtacgcctgacctgttcgctggcgctgctgctgccattggctgcctgcacc
actgcgcccgcccctaccgcctccgttcccacgtccgtcgctgcggctacgccgccgaag
ctgctgctgatctccatcgacggcctgcgcgccgatgcgctggaccgcgggctgaccccg
aacctgcagcggatgatcgacggcggcgtgcgcgctcgctggatgacgccgtcctatcct
tccctgaccttccccaaccactacacgatcgtcaccggcctgcgtccggatcaccacggc
atcgtcaacaacagcatggacgacgcagccctcggccgcttcgaactgggcaaccgtgaa
gcggtgaccgacagccgctggtgggggggtgaaccgatctgggtcggcgcggaaaatgcc
ggcgtgcgcaccgccaccacgtcgtggccgggcagtgaatcggaaatccagggtgtgcgc
cccagccagtggcgcgtctacgacggcaaggaaccgctggagcagcgcgccggcatcgtg
ctcgactggctggcacagaccgatgccgatgctccccgcctgaccacgctgtacatggag
cacgtggacaaggccggccacaactacggccccgggtcgaagcagtatgccgacgcgatc
gtacgcgccgatctgatcgtcggccaggtgctcgacggcctgcagcaacgcggcctggcc
gccaccaccaatgtgatcgtggtatccgaccacggcatggcatcggtgcctgaaagccag
gtgatttccaccgaatcgatggtcgatccggccatcgcacgcaatgtcagccagggccag
tcggtgggcttcgcgccagtggccggtcgtgaggcggaggccgaacgtgccctgctcggc
cgccacgcgcactatgagtgctggaagaaggagaacctgccggcacgctggcactacggc
acccatccgcgcattccggccatcatctgcaacatggatgaaggctgggacgcgctgcac
cagcagaagctcgccaagcgcgtccaccaggaccggggctcgcacggttacgacaatgcc
ctgccgtcgatgcgtgcggtgttcgtggccagcggcccatcgttccgccagggcctggtg
atcgacggcttcgacaatgtcgacgtctacccgctgctggcccacctgctgcaggtgccg
gccgcgccgaacgacggcaatgcggagacgctgaagaagacgttgcgctga

DBGET integrated database retrieval system