KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1271Help
Entry
BurJV3_1271       CDS       T01596                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:buj00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1431594..1433285
Genome map
AA seq 563 aa AA seqDB search
MCSIFGIFGLQAGDDLPALRRHALELSQRQRHRGPDWSGVYLDEGALLVHERLAIVDPAG
GSQPLLSADGQLALAVNGEIYNHQALKAALTTAYDFQTGSDCEVINALYRQGASPAQWLE
QLNGIFAFALWDRDSGRVLVARDPVGVVPLYWGHDAQGRLRVASEMKALVDTCADVAQFP
PGHYFDSARGELVRYYQQPWRDYADVQGRQADLAELRQAFEHAVERQLMSDVPYGVLLSG
GLDSSLVAAVAARYARRRIEDGGQTEAWWPRLHSFAIGLKGSPDLAAAAIAAEALGTVHH
GFEYTFEEGLDALPEVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLSGEGSDEIFG
GYLYFHKAPDAREFHDELVRKLDALHNYDCLRANKSMMAWGVEPRVPFLDREFLDVAMRF
DAAHKMVGAGFGGRRIEKAVLREAFDGYLPDSILWRQKEQFSDGVGYGWIDGLKAHAEAQ
VSDRVLAAADKRFPHNPPQTKEAYYYRHLFEQFFPSRAAAETVPGGKSIACSSPAAIAWD
ASFAAAADPSGRAIAGVHAQALA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgatcttcggaatcttcggcctgcaggccggtgacgatctccccgccctgcgc
cgccatgcgctggaactgtcgcagcgccagcgccatcgtggcccagactggagcggcgtg
tacctcgacgaaggtgcgctgctggtccatgagcggctggccatcgtcgacccggccggt
ggttcgcagccgctgctgtcggccgatggccagctggcgctggcggtgaacggcgagatc
tacaaccaccaggcattgaaggcggcgctgacaaccgcctacgacttccagaccggctcg
gactgcgaggtgatcaacgcgctgtaccgccagggcgcttcgccggcgcagtggctggaa
cagctcaacggcatcttcgccttcgcgctgtgggaccgcgacagcgggcgcgtgctggtg
gcgcgtgacccggtcggcgtggtgccgctgtactggggccacgatgcccagggacggctg
cgcgtcgcctcggaaatgaaggcactggtcgatacctgtgccgacgtcgcgcagttcccg
ccgggccactatttcgacagcgcccgtggcgagctggtgcgttactaccagcagccgtgg
cgcgactacgccgacgtgcagggccggcaggccgacctggccgaactgcgccaggcgttc
gagcatgcggtggagcgccagttgatgagtgacgtgccgtacggcgtgctgctgtccggt
ggcctggactcgtcgctggtggcggcagttgccgcacgctatgcacgtcgccgcatcgag
gatggtgggcagaccgaagcctggtggccgcgcctgcactcgttcgcgatcggcttgaag
ggctcgcccgatctggccgccgctgcgatcgccgccgaagcgctgggcaccgtgcatcac
ggtttcgagtacaccttcgaggaaggcctcgatgcgctgccggaagtgatccgccacatc
gagacctacgacgtcaccaccatccgcgcatcgacgccgatgttcctgctggcgcggcgg
atcaaggcgatgggcgtgaagatggtgctgtccggcgagggcagtgacgaaatcttcggt
ggctacctgtacttccacaaggcgccggatgcgcgtgaattccacgacgagctggtacgc
aagctcgacgccctgcacaactacgactgcctgcgtgccaacaagtcgatgatggcctgg
ggcgtggagccgcgcgtgccgttcctcgaccgtgaattcctcgatgtggcgatgcgcttc
gatgccgcgcacaagatggtcggtgccggttttggtggccgtcgcatcgagaaggcggtg
ctgcgcgaggcgttcgatggctacctgccggacagcattctgtggcggcagaaggaacag
ttcagtgatggcgttggctatggctggatcgatgggctgaaggcacatgccgaagcacag
gtgagcgaccgcgtgctggcggcagccgacaagcgcttcccgcacaacccgccgcagacc
aaggaggcgtactactaccgccacctgttcgagcagttcttccccagccgtgcggcggcc
gagaccgtgccgggtggcaagtcgatcgcctgttcgtcgccggcggccattgcctgggac
gccagcttcgccgccgctgcagatccgtcgggtcgcgcgatcgccggcgtgcacgcgcag
gcactggcctaa

DBGET integrated database retrieval system