KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1515Help
Entry
BurJV3_1515       CDS       T01596                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
buj  Stenotrophomonas maltophilia JV3
Brite
Enzymes [BR:buj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BurJV3_1515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1660565..1661242
Genome map
AA seq 225 aa AA seqDB search
MSPRLRLQPEAVGIGMTSQRVRDRLVDRLREVGIVDESTLNAIRVVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVAPKRVLEVGTGSGYQAAILGALGLEVYTVE
RIGDLLRQARKRFRALGMNIRTKHDDGRAGWAEHGPFDAIVVTAAAPALVDELVGQLAEG
GRLVAPVGGPGGQSLVQLDRRPDGSIEQRVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagtccacgcctgcgattgcagccggaagccgtcggtatcggcatgacctcgcaacgc
gtgcgtgatcgtctggtcgaccgcctgcgtgaagtcggcatcgtcgacgaatccaccttg
aacgcgatccgggtggtgccgcgccatctgttcatcgatgaagcgctggcctcgcgtgcc
tatgaggacaccgcgctgccgatcggccatggccagaccatctcgcagccctgggtggtc
gcgcggatgaccgaggcggtcctccaggtcgcgccgaagcgcgtgctggaagtcggcacc
ggctccggctaccaggccgccatcctcggcgcactgggcctggaggtctacaccgtggag
cgcatcggcgacctgctgcggcaggcacgcaagcgcttccgcgcactgggcatgaacatc
cgcaccaagcatgacgacggacgcgccggctgggccgagcacggcccgttcgatgccatc
gtggtcaccgccgcggcgccggcactggtcgatgaactggtcgggcagctggccgaaggc
gggcgcctggtggcgccggtcggtggcccgggcgggcagtcgctggtgcagctggaccgc
aggcccgatggcagcatcgaacagcgcgtgctggcgccggtcacgttcgtgccgctgctg
tctggcatgctcgactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system