KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1525Help
Entry
BurJV3_1525       CDS       T01596                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:buj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1668814..1669710
Genome map
AA seq 298 aa AA seqDB search
MFDTSPQLDCAGRILRLDRARVMGIVNVTPDSFSDGGAHDTTESAVAHGLKLVEEGADLL
DIGGESTRPGAAPVSVEDELRRVIPVIEQLAARSRVPISIDTFKPEVMRAAVAAGAGMIN
DIYGLRQDGALDAAAEAGVPVVLMHMQGEPGHMQADPHYDDVVAEVHGFLVQRLFAAEMA
GIAKKNLLVDLGFGFGKTTAHNMTLLARSERFLELGVPMLAGLSRKRSLGELTGRDLPSE
RVAASVAAHLIAVQRGARIVRVHDVAATVDALKVWQAVEAVPTPRADAAPTIRWPDED
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatacctcgccccagctcgattgcgccggccgcatcctgcgcctcgaccgtgcc
cgggtcatgggcatcgtcaacgtcaccccggactcgttctccgatggcggcgcgcacgac
accaccgagtcggcggtcgcccatggcctgaagctggtcgaggagggtgcggacctgctc
gacattggtggcgaatcgacccgcccgggcgccgcgccggtatcggtcgaggacgagctg
cgccgggtgattccggtgatcgagcagctggccgcccgtagccgggttccgatcagcatc
gacaccttcaagccggaggtgatgcgtgcggccgtggccgccggcgcgggcatgatcaat
gacatctacggcctgcgccaggacggtgcgctggatgccgccgctgaagccggcgtgccg
gtggtgttgatgcacatgcagggtgaacccggccacatgcaggctgatccgcactacgac
gacgtcgttgccgaggtgcacggtttcctggtgcagcgcctgttcgctgctgaaatggcc
ggcatcgcgaagaagaacctgctggtcgacctcggtttcggcttcggcaagaccacggcc
cacaacatgaccctgctggcgcgctcggaacgcttcctggaactgggcgtgccgatgctg
gccggcctgtcgcgcaagcgcagccttggtgagctgactggtcgcgacctgccgtccgag
cgggtcgcggcctcggtggccgcgcatctgatcgcggtgcagcgcggcgcacgcatcgtg
cgcgtgcatgacgtggcggccaccgtcgatgcgttgaaggtctggcaggcggtcgaggcg
gtgcccacgccgcgcgccgacgccgcgccgacgatccgttggccggacgaagactga

DBGET integrated database retrieval system