KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1542Help
Entry
BurJV3_1542       CDS       T01596                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BurJV3_1542
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BurJV3_1542
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BurJV3_1542
Enzymes [BR:buj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BurJV3_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1691472..1693067
Genome map
AA seq 531 aa AA seqDB search
METINRRRFLALAGLSAAGAWMGTARALAAQADAAALNPRNLLASPRFASTPFTLGVASG
DPSADGMVLWTRLATEPLVFGGGMPTRPMVVEWQLAADERMRKVVRQGSAMAHPELGHAV
HVELEGLAPGRPYWYRFTVGGHASAVGCTRTLPAATTAVDRVRFAVAGCQHYEEGHYTAW
RRIAEEPLDFVFHYGDYIYEGESQPGLRKMNGQPFTNLRNHVGPQTYTLDDYRRRYAQYK
SDADLQAAHASAPWFVTFDDHEVDNNWAGAEDQDDTPSEVFLLRRAQAFQAYYENMPLRR
SAFPRDGHMQLYRRARYGTLMDLHLLDTRQYRSKQVNMALREEVESPQRSIVGAKQERWL
FDGLADAAPRWHTIAHQVALGNYMREKDGAVQSSDDQWSGYLDSRRRLLDHIQKVGFGNV
VTACGDAHRHYASDLVQDHRDSGVVSSEFLATSITSGADGQGVDAYARNQLAHSPYLKAT
TDKRGYVLCDVTRDAWIGDMKTLDSVMRPNGTVQSWKRYAVEHGRPGLQDA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtggagacgatcaatcgcaggcgattcctggcactggccggcctgtccgctgctggcgcc
tggatgggcacggcgcgcgcgctggccgcacaggccgatgccgctgcgctgaacccgcgc
aacctgctggcctcgccgcggttcgccagcacgccgttcaccctgggcgtggcctcgggt
gatccttcggccgatggcatggtgctgtggacacggctggcgaccgagccgctggtgttc
ggcggcggcatgccgacccggccaatggtggtcgaatggcagctggccgcggacgagcgc
atgcgcaaggtggtgcgccagggttcggcgatggcgcatcccgagctgggccatgccgtg
cacgtggagctggaagggttggcaccgggccgaccctactggtatcgcttcacggtgggc
ggccatgccagtgcggtgggctgcacgcgcacgctgcctgcggccacgacggcggtggac
cgggtgcgcttcgcggtggctggctgccagcactacgaagagggccactacaccgcgtgg
cggcgcatcgccgaggaaccgctggacttcgtcttccactacggcgattacatctacgaa
ggcgaaagccagccgggcctgcggaagatgaacggccagccgttcaccaacctgcgcaat
catgtcgggccgcagacgtacacgctggacgactaccgccgccgctacgcccagtacaag
agcgatgccgacctgcaggccgcacatgcgtcggcaccatggttcgtcaccttcgatgac
catgaagtggacaacaactgggccggtgccgaagaccaggacgatacgcccagcgaagtg
ttcctgctgcgccgcgcgcaggcgttccaggcctactacgagaacatgccgctgcgtcgc
tcggcattccctcgcgatggccacatgcagctgtaccggcgcgcacgctacggcacgctg
atggacctgcacctgctcgacacacgccagtaccgcagcaagcaggtgaacatggcgctg
cgtgaggaggtggaatcaccgcagcgcagcattgtgggtgcgaagcaggagcgctggctg
ttcgacggcctggccgatgccgcgccgcgttggcacaccatcgcccaccaggtggcgctg
ggcaactacatgcgcgagaaggacggcgcggtgcagtcgtccgatgaccagtggtcgggt
tatctggacagccgccggcgcctgctcgaccacatccagaaggtcggcttcggtaacgtg
gtgaccgcctgtggcgacgcgcaccggcattacgccagcgacctggtgcaggaccatcgt
gattcgggcgtggtctccagcgaattccttgccacctcgatcacgtccggtgccgacggc
cagggcgtggacgcgtacgccaggaatcagctcgcgcacagcccttacctgaaggcgacc
accgacaagcgtggctatgtgctgtgcgatgtcacccgtgatgcatggatcggcgacatg
aagacgctggattccgtgatgcgtccgaacggtaccgtgcagagctggaagcggtacgcg
gtggagcacggccggccgggattgcaggacgcctga

DBGET integrated database retrieval system