KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1564Help
Entry
BurJV3_1564       CDS       T01596                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:buj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1719740..1720225
Genome map
AA seq 161 aa AA seqDB search
MTLAWIGLGANLGDAAATVGAAIAALDGLPGTRLRQASRLYATPAWGNEDQPPFVNAVAS
VETTLPADELLQAMLALEQGFGRVRDPAMHWGPRALDLDLLLYGMQVLDQPGLQVPHPYL
HERAFVLVPLAEIAPELTIPGHGRVQDAVMRVDACGIAPIG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgcctggatcggcctcggcgccaacctcggcgacgcggccgccaccgtcggc
gcggcgattgccgcgctggacggcctgcccgggacccgcctgcgccaggcctcgcgcctg
tatgccacgccggcctggggcaatgaagaccagccgccgttcgtcaacgcggtggcctcg
gtcgaaaccacgctgccggccgatgagctgctgcaggcgatgctggcactggagcagggt
tttggccgcgtgcgcgatccggcgatgcactgggggccgcgcgcgctggacctggacctg
ctgctgtatggcatgcaggtactcgatcagcccggcctgcaggtgccgcatccgtacctg
cacgagcgtgccttcgtgttggtgccgctggccgaaatcgcgccggaactgacaattcct
ggccatggacgcgtgcaggatgcagtgatgcgggtcgatgcctgcgggatcgcgccgata
gggtga

DBGET integrated database retrieval system