KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1698Help
Entry
BurJV3_1698       CDS       T01596                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BurJV3_1698
   00052 Galactose metabolism
    BurJV3_1698
   00500 Starch and sucrose metabolism
    BurJV3_1698
   00520 Amino sugar and nucleotide sugar metabolism
    BurJV3_1698
Enzymes [BR:buj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BurJV3_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1861392..1862270
Genome map
AA seq 292 aa AA seqDB search
MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLVFITNR
YKHAVADYFDKAYELEQKLERAGKQEQLELIRHVLPNGVRAIFVTQAEALGLGHAVLCAK
AVIGDEPFAVLLPDDLIWNRGAGALKQMADLNEASGASVIAVEDVPHDKTASYGIVATEA
FDGRKGRISQIVEKPKPEDAPSDLAVVGRYVLSPKIFELLEQTQTGAGGEIQLTDAIAQL
LKTEEVDAYRFEGTRFDCGTHLGLVEATIRFALDNPKLAGPAREKLAAMLAE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgaattcgcaaagcagttttcccggtggcagggttggggacgcgttttttg
ccagcaaccaagactgtgccgaaggagatgctgccgatcattgatcggccgctgatccag
tacgccgtggatgaggcgatcgaagccggctgcgacacgctggtgttcatcaccaaccgc
tacaagcacgccgttgccgactatttcgacaaggcctacgagctggagcagaagctcgag
cgcgctggcaagcaggagcagctggaattgatccggcacgtgctgcccaatggtgtgcgc
gcgatcttcgtgacccaggccgaagccctgggcctcgggcacgcggtgctgtgtgccaag
gcggtgatcggtgatgagccgtttgccgtgctgctgcctgacgacctgatctggaaccgg
ggtgcgggcgcgctgaagcagatggccgacctcaacgaagccagtggcgccagcgtgatc
gcggtcgaagacgtaccgcacgataagaccgccagttacggcatcgtcgccaccgaggcg
ttcgatggccgcaagggccgtatttcgcagatcgtcgagaagccgaagccggaggacgcg
ccgagcgacctggccgtggtcggccgttacgtgctcagcccgaagatcttcgagctgctg
gagcaaacccagaccggtgctggcggcgagatccagctgaccgatgcgatcgcgcagctg
ctgaagaccgaagaggtcgatgcgtaccgcttcgagggcacccgcttcgattgcggcacg
catctggggctggtggaggcgacgatccgcttcgcgctggataacccgaagctggctggc
ccggcgcgggagaagctggccgcgatgctggcggaataa

DBGET integrated database retrieval system