KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1727Help
Entry
BurJV3_1727       CDS       T01596                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BurJV3_1727
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BurJV3_1727
Enzymes [BR:buj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BurJV3_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1900385..1901167
Genome map
AA seq 260 aa AA seqDB search
MFSGKVAVVTGSTSGIGLGIATALARQGADIVLNGFGDAAEIERLRSRLETEFGVRVAHD
GADLSRGEAVRGMIDRAVATMGRIDILVNNAGIQHTASIEEFPVEKWDAILALNLSAVFH
ATAAVLPYMKQQGAGRIINIASVHGLVGSVNKSAYVAAKHGVVGFTKVTALENAGTGITA
NAICPGWVRTALVEQQITALAEREGTDQETAARALLAEKQPSLQFVTPEQLGEMVVFLAS
DAAAQITGTALPVDGGWTAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttctctggaaaggttgcggtggtcaccggctccaccagcggtatcggtcttggcatt
gccacggcgctggcgcggcagggtgccgacatcgtgctgaatggctttggcgatgcggcg
gagattgaacgcctccgttcccggttggaaaccgagttcggcgtgcgagtggcgcatgac
ggtgctgacctgtcgcggggtgaggcggtgcgcgggatgatcgaccgcgcggttgcgacg
atggggcgcatcgacattctggtgaacaacgcgggcatccagcacaccgcgtcgatcgag
gaatttccggtcgagaagtgggatgcgatcctggcgctgaatctgtcggcggtattccat
gcaacggcggcggtcttgccctacatgaagcagcagggcgccggtcgcatcatcaacatc
gcgtcggtgcatggtctggtgggttcggtgaacaagtcggcctacgtggcggccaagcac
ggcgtggtggggttcaccaaggtgaccgcgctggagaatgcgggcaccggcatcaccgcc
aatgcgatctgcccgggttgggtgcggaccgcgctggtcgagcaacagatcactgccttg
gccgagcgcgagggtacggatcaagagaccgccgcgcgcgcgctgctggctgagaaacag
ccctcgctgcagttcgtgacgcccgagcagctgggagaaatggtggtgttcctggcctcg
gacgccgcggcccagatcaccggcacagcgttgccggtagatgggggctggacggcgcgc
tag

DBGET integrated database retrieval system