KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1797Help
Entry
BurJV3_1797       CDS       T01596                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:buj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BurJV3_1797
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BurJV3_1797
Enzymes [BR:buj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BurJV3_1797
Two-component system [BR:buj02022]
 CheA family
  CheA-CheYBV
   BurJV3_1797
Bacterial motility proteins [BR:buj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BurJV3_1797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1971843..1972418
Genome map
AA seq 191 aa AA seqDB search
MALPTRPAVLVIGASAGGVAALQAVLGALPAALPAPVLAVLHLPRDRSSRIAEVLAPYCA
LPVREAEDKQPLQRGTVTFAPPDYHLLVEDAGSLALSVDAPVLFSRPAIDPLFESAAAVF
GAQVLALLLTGASSDGSEGVAAVRAAGGRAWLQCPEEAEASMMPASALQHAGADAVLPLE
LMCRRLKELFA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgccgacacgcccggccgtgctggtgatcggcgcctctgccggtggggtcgcg
gccctgcaggcggtgctcggcgcgctgccggcggcgctgcccgcgccggtgctggccgtg
ctgcacctgccacgcgaccgcagcagccgcatcgccgaagtgctggcgccttactgcgcg
ctgccggtgcgcgaggctgaagacaagcagccgctgcagcgtggcacggtgaccttcgcg
ccaccggactatcacctgctggtggaagacgccggttcgctggcgttgtcggtcgacgct
ccggtgctgttttcgcgcccggccatcgatccgctgttcgagtcggcagcggcggtgttc
ggcgcgcaggtgctggccctgctgctgaccggtgccagcagtgacggcagcgaaggcgtg
gctgcggtgcgcgccgctggcggccgcgcctggctgcaatgtcccgaggaggccgaggca
tcgatgatgccggcctctgccctgcagcacgctggcgctgatgccgtgctgccccttgaa
ctgatgtgccgtcgcctgaaggagttgtttgcatga

DBGET integrated database retrieval system