KEGG   Stenotrophomonas maltophilia JV3: BurJV3_1809Help
Entry
BurJV3_1809       CDS       T01596                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BurJV3_1809
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BurJV3_1809
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BurJV3_1809
Enzymes [BR:buj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BurJV3_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1982959..1984245
Genome map
AA seq 428 aa AA seqDB search
MQFVSTRGQSPAVGLSAAIAAGLAPDGGLYVPALLPAARELQAGPTLADTAADLLSPFFA
GDLLETALPAICREAFDFPVPLRALGDGDHVLELFHGPTAAFKDIGARFLAGTLSRLQAG
KDRDLTIVVATSGDTGAAVAAAFHRQPGVRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGAFDDCQAMVKQALADRELQAQVPLSSANSISLGRLLPQMSYYAHAALTHYAAHRRRLN
LVVPTGNLGNAMAAVLARALGVPIGQIVLATNANAVLPAYFNGGDYQPQASVATVANAMD
VGAPSNFERLRWLYHGDDAELRAAFRAFAVDDVTIRATIAAAHASRGELFCPHTATAVKV
LQDLRARGAKGDWAVVATAHPAKFEAVVEPLIGEAVAVPPALDALLQRPAHAEPLAADYT
ALREVLLR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgtttcgacccgcggccagtctccagccgttggcctcagcgcggcaatcgcc
gccggattggcgcctgatggcgggctgtatgtccccgcgcttctgccggccgcccgcgaa
ctgcaggccgggccgaccctggccgataccgctgccgatctgctgtcaccgttctttgct
ggcgacttacttgagaccgcgcttccggcgatctgccgcgaagcgttcgacttcccggtg
ccactgcgtgcgctcggcgacggtgaccacgtgctggagctgttccatgggccgaccgca
gcgttcaaggatatcggcgcgcgcttcctggccggtacgctgtcgcggctgcaggccggc
aaggaccgcgatctgacgatcgtcgtcgccacgtccggcgataccggtgccgccgttgcg
gcggccttccatcgccagccgggcgtgcgcgtggtggtgctgtatccggatggccgcgta
tctccgcgccaggcgcatcagctcggttgtttcggcgacaacatccaggctctgcgtgtg
gcgggcgcattcgacgattgccaggcgatggtcaagcaggcgctggctgaccgcgaactg
caggcgcaggtgccgttgagctcggccaacagcatcagcctgggccgactgctgccgcag
atgagctactacgcgcatgcagcgttgacccactacgccgcgcatcgtcgccggctcaat
ctggtggtgccgaccggcaacctgggcaatgcgatggcagcggtgctggcgcgtgcgctg
ggtgtgccgatcggtcagatcgtgctggccaccaatgccaatgcggtgctgccggcgtac
ttcaatggcggcgactaccagccgcaggcgagtgtggcgacggtggccaatgcaatggac
gtcggtgcgccgagcaacttcgagcgactgcgctggctctaccacggcgacgacgcggaa
ctgcgtgctgcgttccgcgcgttcgcggtggatgacgtgaccatccgcgcgacgattgcg
gcagcgcatgccagccgcggcgagctgttctgcccgcacacggcgacggcggtgaaggtg
ctgcaggacctgcgtgcgcgcggtgccaagggcgactgggcggtggtggccacggcgcat
ccggccaagttcgaggccgtggtcgagccgctgatcggcgaagcggtggcggtgccgcct
gcgctggatgcgttgctgcagcggccggcgcacgccgaaccgttggcggccgattacacg
gcgttgcgtgaggtgttgctgcgctga

DBGET integrated database retrieval system