KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2292Help
Entry
BurJV3_2292       CDS       T01596                                 

Definition
nitrate reductase subunit alpha (EC:1.7.99.4)
Orthology
K00370  
nitrate reductase alpha subunit [EC:1.7.99.4]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BurJV3_2292
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BurJV3_2292
Enzymes [BR:buj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With other, unkown, acceptors
    1.7.99.4  nitrate reductase
     BurJV3_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2528983..2532738)
Genome map
AA seq 1251 aa AA seqDB search
MSYFLDRLQFFKRDPQTFADGHGFAKSEGRDWENSYRARWQYDKIVRSTHGVNCTGSCSW
KIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLKYPLIRGTLLR
LWREARKSKAPVDAWASIVEDKEKARSYKTRRGMGGFVRLQWEEANEIIAASNLYTVKQY
GPDRVVGFSPIPAMSMVSYAAGARYLSLLGGACLSFYDWYCDLPPASPQIWGEQTDVPES
ADWYNSRYIIAWGSNVPQTRTPDAHFFTEARYNGTKTVAICPDYSELAKLTDHWLHPKQG
TDAALAFAFGHVILREFHVDSPSQYFQDYCRQYSDMPMLVRLERRDDGRLVPGRFLRASE
LGGLGEANNPDWKTLAYDENSGQIVVPNGSIGFRWGEKGKWNIEEKESKGADTRLRLSLA
DGNEGIEAVSFPYFGGIETDGWTAAPADEVLERNIPVRRLALADGGETLVATVYDLLLAQ
YGVDRGFGGGSVARSFDDMVPGTPAWQERITGVSRAEVIEIAREFARTADKTHGRSMIIV
GAGMNHWFHNDMNYRGLINMLIMCGCVGQTGGGWAHYVGQEKLRPQTGWQPLAFGLDWSR
PPRHMNGTSFFYFNTGQWRYEKLQVDELLSPLADASKYSGSLADLNLRAVRMGWLPCAPQ
LDRNPLQLVREADAAGVAPADYALGKFKDGSLDFAFADPDAQQNHPRMMFIWRSNLLGSS
GKGHEYMLRHLLGTRHGLQGKDLGEMGAIKPEEVTWRDEAPEGKLDLLVTLDFRMCTTAL
YSDIVLPTATWYEKDDLNTSDMHPFIHPLSKAVDPAWESRSDWEIFKEVARTVSEMAPGV
MGVEKDLVLVPTLHDTPNELGMPFGVADWKKGECEAIPGQTMPSMTVVERDYPNLYRKFT
SLGPLLDTLGNGGKGMSWDTKHEVEFLGKLNHTVHEEGVSQGRPAISTAIDAAEVILHLA
PETNGHVAVKAWESLGTFTGREHTHLAVGKEHEAIRFRDIQAQPRKIISSPIWSGLEDDN
VSYNAGYTNVHELIPWRTVTGRQQFYQDHEWMIDFGEAFMSYRPPVNTRTVEPLLNQRPN
GNKEIVLNWITPHQKWGIHSTYSDNLIMQTLSRGGPIVWISEDDARSAGIVDNDWIELFN
VNGAIAARAVVSQRVMPGMAMMYHAQERIINVPGSEISGTRGGIHNSVTRIVLKPTHMIG
GYAQLAYGFNYYGTCGTNRDEFVIVRKMDRIDWLDDEQPAGASASASKEVV
NT seq 3756 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttcctcgatcgcttgcagttcttcaagcgtgacccccagacctttgccgat
ggccacggattcgccaagagcgaaggccgtgactgggaaaacagctaccgcgcccgctgg
cagtacgacaagatcgtgcgttccacccacggcgtgaactgcaccggttcgtgcagctgg
aagatctacgtcaagaacggcctggtcacctgggaaacccagcagaccgactacccgcgc
acgcgcccggacctgcccaaccacgaaccgcgtggctgcccgcgtggcgccagctattcc
tggtacctgtacagcgccaaccggctgaagtacccgctgatccgcggcacgctgctgcgc
ctgtggcgcgaagcccgcaagagcaaggccccggtcgatgcctgggccagcatcgtcgag
gacaaggagaaggcgcgttcgtacaagacccgccgcggcatgggcggcttcgtgcgcctg
cagtgggaagaggccaacgagatcatcgccgcctccaacctgtacacggtgaagcagtat
ggcccggaccgtgtggtcggcttctcgccgatcccggcgatgtcgatggtgtcctacgcc
gccggcgcgcgctacctgtcactgctgggcggcgcctgcctgtccttctatgactggtac
tgcgatctgccgccggcctcgccgcagatctggggcgagcagaccgacgtgcccgaatcg
gccgactggtacaacagccgctacatcatcgcctggggctcgaacgtgccgcagacgcgt
acgcccgatgcgcacttcttcaccgaggcgcgctacaacggcaccaagacggtggcgatc
tgcccggactattccgagctggccaagctgaccgaccactggctgcaccccaagcagggc
accgacgcggcactggcctttgccttcggtcatgtgatcctgcgcgagttccatgtggat
tcgccctcgcagtatttccaggactattgccgccagtactcggacatgccgatgctggtg
cgcctggagcgtcgcgacgatggccgcctggtgccgggccgcttcctgcgtgccagtgag
ctgggcgggctgggtgaagccaacaacccggactggaagaccctggcctacgacgagaac
agtggccagatcgtggtgccgaacggctcgatcggcttccgctggggcgagaagggcaag
tggaacatcgaggaaaaggaaagcaagggcgccgatacacgcctgcgcctgagcctggcc
gatggcaatgagggcatcgaagcggtgagcttcccgtacttcggtggcatcgagaccgac
ggctggaccgcggcaccggccgatgaggtgcttgagcgcaacatcccggtgcgtcgcctg
gccctggccgacggcggcgaaaccctggtggccacggtctacgacctgctgctggcccag
tacggcgtagaccgtggcttcggcggcggcagcgtggcgcgcagtttcgacgacatggtg
ccgggcaccccggcgtggcaggagcgcatcaccggcgtgtcgcgcgccgaggtgatcgag
atcgcccgcgagttcgcccgtaccgccgacaagacccatggccgctcgatgatcatcgtc
ggcgcgggcatgaaccactggttccacaacgacatgaactaccgcggcctgatcaacatg
ctgatcatgtgcggttgcgtgggccagaccggtggtggttgggcgcattacgtgggccag
gagaagctgcgcccgcagaccggctggcagccgctggcgttcggcctggactggagccgc
ccaccccgccacatgaacggcacctcgttcttctacttcaacaccgggcagtggcgctac
gagaagctgcaggtggacgaactcctgtcgccgctggcggatgccagcaagtacagcggc
agcctggccgacctgaacctgcgcgcggtgcgcatgggctggttgccgtgtgcgccgcag
ctggaccgcaacccgctgcagctggtacgcgaggcggacgcggcgggtgttgccccggcc
gactacgcgctgggcaagttcaaggacggctcgctggacttcgccttcgccgatccggat
gcacagcagaaccatccgcggatgatgttcatctggcgctcgaacctgctcggttcctcg
ggcaagggccacgaatacatgctgcggcacctgttgggcacgcgccatgggctgcagggc
aaggacctgggcgagatgggggcgatcaagccggaggaagtgacgtggcgtgacgaggca
ccggagggcaagctggacctgctggtcacgctcgacttccgcatgtgcaccaccgcgctg
tactcggacatcgtgctgccgacggcgacctggtacgagaaggacgacctcaacacctcg
gacatgcacccgttcatccacccgctgtcgaaggcggtggacccggcgtgggaatcgcgc
agcgactgggagatcttcaaggaggtcgcccgcaccgtgagcgagatggcgccgggcgtg
atgggcgtggagaaggatctggtgctggtgccgaccctgcatgacacccccaatgaactg
ggcatgccgttcggcgtggccgactggaagaagggcgaatgcgaggccatcccgggccag
accatgccgtcgatgacggtggtggagcgcgactacccgaacctgtaccgcaagttcacc
tcgctgggcccgctgctggacacgctgggcaacggcggcaagggcatgagctgggacacg
aagcacgaggtcgagttcctcggcaagttgaaccataccgtgcacgaagaaggcgtaagc
cagggccgcccggccatctcgaccgcgattgacgcggccgaagtgatcctgcacctggcg
ccggaaaccaacggccacgtggcggtgaaggcctgggaatcgctgggcaccttcaccggt
cgcgagcacacccacctggcggtgggcaaggagcacgaggcgatccgcttccgtgacatc
caggcacagccgcgcaagatcatttcctcgccgatctggtcgggcctcgaagacgacaac
gtcagctacaacgccggctataccaacgtccacgagctgattccgtggcgcacagtgacc
ggccgccagcagttctaccaggaccatgagtggatgatcgacttcggcgaggccttcatg
agctatcgcccgccagtcaacacgcgcacggtggagccgctgctgaaccagcgcccgaac
ggcaacaaggagatcgtgctgaactggatcacgccacaccagaagtggggcatccacagc
acctacagcgacaacctgatcatgcagacgctgtcgcggggtggcccgatcgtgtggatc
agcgaggacgacgcgcgcagcgccggcatcgtcgacaacgactggatcgagctgttcaac
gtcaacggtgcgatcgccgcgcgtgcggtggtcagccagcgcgtgatgccgggcatggcg
atgatgtaccacgcccaggaacgcatcatcaacgtgccgggctcggagatttccgggacc
cgcggcggcatccacaactcggtgacccgcatcgtgctcaagcccacccacatgatcggc
ggctacgcgcagctggcctacggcttcaactactacggcacctgcggcaccaaccgcgac
gagttcgtgatcgtgcgcaagatggacaggatcgattggctggacgatgaacagcccgct
ggtgcttcggcatcggccagcaaggaggtggtgtga

DBGET integrated database retrieval system