KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2633Help
Entry
BurJV3_2633       CDS       T01596                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:buj00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:buj00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2903493..2904080)
Genome map
AA seq 195 aa AA seqDB search
MPLPTVIPRRLRGLSLLTLLVAGLAGSAHVLAADLLDLDYRPLASKQQVNLQQRYHGQVL
LVVNTASKCGYTPQYEGLEALQKRYAGRGFAVLGFPSNDFKGQEPGDEKQIQDFCTLTYG
VKFPMFEKVHVVGAEATPLYQRLTAATGVAPGWNFHKYLVGRDGKVIAQFASKVTPDDPQ
LTEAIDKALAAAATH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgccgaccgttatcccgcgccgcctgcgcggcctgtccctgctgaccctgctg
gtggccggcctggccggttccgcccatgtactggcggccgatctgctggacctggactat
cgcccgctggccagcaagcagcaggtcaacctgcagcagcgctaccacgggcaggtgctg
ctggtggtcaataccgcaagcaagtgcggctataccccccagtacgaaggcctggaggcg
ctgcagaagcgctatgccggccgcggctttgccgtgctcggtttcccgtccaacgatttc
aagggccaggaaccgggtgacgagaagcagatccaggatttctgcacgcttacctatggc
gtcaagttcccgatgttcgagaaggtgcacgtcgtcggtgcggaggccacgccgttgtac
cagcggctgaccgcagccaccggcgtggcgccgggctggaacttccacaagtacctggtc
ggccgcgatggcaaggtcatcgcccagttcgccagcaaggtgacgccggacgatccacag
ctgaccgaggcgatcgacaaggcgctggccgccgccgctacgcattga

DBGET integrated database retrieval system