KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2647Help
Entry
BurJV3_2647       CDS       T01596                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BurJV3_2647
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BurJV3_2647
  Amino acid metabolism
   00310 Lysine degradation
    BurJV3_2647
Enzymes [BR:buj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BurJV3_2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2918364..2919566
Genome map
AA seq 400 aa AA seqDB search
MATEVKAPVLPESVADGTIATWHKKVGDAVKRDENLLDLETDKVVLEVPSPVDGVLKEIK
FAEGSTVTSSQVVAIIEEGAVAAAPAPAAEAAPAAAAAPAAAAPAAAAAPAPAAKSAADA
LPPGARFTAITEGVNPADVDGTGRRGAVTKEDIVNFARNGGAGKAGGARPEERVPMTRIR
KRIAERLMESKNSTAMLTTFNEVDLSKVSAARKELQDEFVKAHGIKLGFMSFFVKAAANA
LQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVTPVLRNVERMSFADIEKTIADYAKK
ARDGKLSLEELQGGTFTVTNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAQNGQVVIA
PMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagccccggtactgcccgaatccgtcgccgacggcaccatcgcc
acctggcacaagaaggtgggcgacgccgtcaagcgcgacgaaaacctgcttgacctggaa
accgacaaggtcgtcctggaagtgccgtcgccggtcgacggcgtgctcaaggaaatcaag
ttcgccgaaggttcgaccgtgacctccagccaggtcgtggcgatcatcgaggaaggcgcc
gtcgctgctgccccggctccggccgctgaagccgctccggctgccgctgctgccccggcc
gctgcggctccggccgcagccgctgctccggccccggctgccaagtcggccgccgacgcg
ctgccgccgggcgcccgcttcaccgccatcaccgaaggcgtgaacccggccgacgtcgac
ggcaccggccgtcgcggcgcggtgaccaaggaagacatcgtcaacttcgcccgcaacggc
ggcgccggcaaggccggtggcgcacgtccggaagaacgcgtgccgatgacccgcatccgc
aagcgcatcgccgagcgcctgatggagtcgaagaactccaccgccatgctgaccaccttc
aacgaagtcgacctgtccaaggtgtcggcggcgcgcaaggaactgcaggacgagttcgtc
aaggcacacggcatcaagctgggcttcatgagcttcttcgtgaaggccgctgccaacgcg
ctgcagcgcttcccgctggtcaacgcctcgatcgacggcgacgacatcatctaccacggc
tattcggacatctcgatcgccgtgtcgaccgagaagggcctggtcacgccggtgctgcgc
aacgtcgagcgcatgtcgttcgccgacatcgagaagaccatcgccgactacgccaagaag
gcgcgtgacggcaagctgagcctggaagaactgcagggcggcaccttcaccgtgaccaac
ggcggcaccttcggttcgctgctgtcgaccccgatcatcaacccgccgcagagcgccatc
ctgggcatgcacgccatcaaggagcgtccgatcgcccagaacggccaggtcgtgatcgcg
ccgatgatgtacctggcgctgtcgtacgaccaccgcatcatcgacggcaaggactcggtg
cagttcctggtggacatcaagaaccagctggaaaacccgggccgcatgctgttcggcctg
taa

DBGET integrated database retrieval system