KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2652Help
Entry
BurJV3_2652       CDS       T01596                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00790  Folate biosynthesis
buj01100  Metabolic pathways
buj02020  Two-component system
Module
buj_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BurJV3_2652
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BurJV3_2652
Enzymes [BR:buj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BurJV3_2652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AEM51972
JGI: BurJV3_2652
UniProt: G0JUZ6
Position
complement(2923480..2925069)
Genome map
AA seq 529 aa AA seqDB search
MRGPVDPERRRRLLRMAWQGTGAAIALAAMPGLATAGPRPRLGRDPFTLGVAAGDPDPQG
AVLWTRLAPDPLNGGGVPSRAVPVRWFVAEDPGMRRLVQRGVAAAVPELAHSVHVEVNGL
RPGRDYYYRFACDGDEESAVGHFRTAPLLDAQLQQLRLALCTCQAWNSGYYPVLRDIAKS
DVDLVLHAGDYLYEYSPLQNARGLTLDAERFSGETVSLERYRDQYALYKLDPDLQAAHAA
HAFAVIWDDHEVQNDYSGIHPEKPGVSTEDFIVRRAAAYRAFYEHLPMRSSPVGNGGLRV
HRRLRYGDLAQLTLLDCRQFRPANPCGVGESPRCDAALDPRMSMLGMGQEAWFAQSMAAA
QGTRWNVVVQQLLMAQLRLDGGTPRERFWNDAWDGYPAARNRLLQAMQAGGQGNAIVLGG
DWHSSFVNDLKLDFDAASVPVVATEFIAPAISSGGDDTPYGPYYGPSIPQNPHIRYFDGD
RRGWWKLQLNRQTVDAELRFADSVLRPDAAVRTAARFQVTHGRPGAVPV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggcctgtcgatccggaacgccgtcgtcgtctgctgcgcatggcgtggcagggc
acgggggcggcgatcgcgctggcggcgatgccggggctggccacggccggcccacggccg
cggctggggcgcgatccgttcaccctcggtgtcgccgccggtgatccggatccacagggg
gccgtgttgtggacgcggctggcaccggacccgctcaatggcggtggcgtgccgtcgcgg
gcggtgccggtgcgctggttcgtggccgaagaccccggcatgcgccggctggtgcagcgc
ggcgttgctgccgcggtgccggagctggcccactcggtgcacgtggaggtcaacggcctg
cgcccaggccgcgactactactaccgttttgcctgcgacggcgatgaggaaagcgcggtc
ggccacttccgcaccgcgccgctgctggacgcgcagctgcagcagctgcggctggcgctg
tgcacctgccaggcctggaacagtggctactacccggtgctgcgcgatatcgcgaagagt
gatgtcgacctcgtgctgcatgcgggcgactacctgtacgaatacagcccgctgcagaac
gcgcgtggtcttacgctggatgccgagcgcttcagtggcgagaccgtcagcctggagcgc
taccgtgaccagtacgcgctttacaaactcgatccggatcttcaggccgcgcacgccgca
cacgcgttcgcggtgatctgggacgaccatgaagtgcagaacgattactccggcatccac
ccggaaaagccgggcgtatcgaccgaagatttcatcgtgcgtcgtgcggcagcctatcgc
gcgttctacgaacacctgccgatgcgcagctcgccggtgggcaatggcggcctgcgcgtg
catcggcgcctgcgctatggcgacctggcacagctgacgctgctcgattgccgtcagttc
cgcccggccaatccctgtggcgtcggcgagtcgccacgctgtgatgccgcactggacccg
cgcatgagcatgctcggcatgggccaggaagcgtggttcgcgcagtcgatggccgcggcg
caaggcacgcgctggaacgtggtggtgcagcagctgctgatggcgcagctgcggctggac
ggcggcacgccacgcgagcgcttctggaatgacgcctgggatggctatcccgccgcacgc
aaccggttgctgcaggcgatgcaggcgggcgggcagggcaatgccatcgtgctgggcggt
gactggcattcctctttcgtcaacgatctgaagctggatttcgacgcggccagtgtgccg
gtcgtggccaccgaattcatcgccccggcgatcagcagtggcggcgacgacacgccctac
gggccgtactacgggccgtcgattccgcagaatccgcatatccgctatttcgacggcgac
cgccgtggctggtggaagctgcagctgaaccggcagaccgtggacgccgagctgcgcttc
gccgacagcgtgctgcgcccggatgcggcggtgcgtacagcggcgcgtttccaggtgacc
cacggccgcccgggcgcagtcccggtgtga

DBGET integrated database retrieval system