KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2668Help
Entry
BurJV3_2668       CDS       T01596                                 

Definition
phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BurJV3_2668
   00565 Ether lipid metabolism
    BurJV3_2668
   00590 Arachidonic acid metabolism
    BurJV3_2668
   00591 Linoleic acid metabolism
    BurJV3_2668
   00592 alpha-Linolenic acid metabolism
    BurJV3_2668
Enzymes [BR:buj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     BurJV3_2668
    3.1.1.32  phospholipase A1
     BurJV3_2668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2940817..2941971
Genome map
AA seq 384 aa AA seqDB search
MTLPTLLPRLAPLALALASAPLAAQEFVPSTDTSPAACAAITTDAARLACYDRLFAHTPQ
ATAAADAAAEAAAQARREERQTARVSQGEEKLRERVSDLFRPAAPDSALANAGRGSLLDS
RWELAEDSKLGPFQLRAYKPVYLLPAFWTSDRNTMPHSPNPANSVTTPQVLDSAELKFQI
SFKTKIAENLFGDNGDIWAGYTQSSRWQAYNSEDSRPFRETNYEPEVMMVFRNGYSIGGW
RGRMTGISLNHQSNGRADPLSRSWNRVMLNIGLDRENWALVLRPWYRIPESRSEDNNPDI
EDYMGRGDATLIWNRNGHEVALMARHSLRTGSRSHGALQLDYGFPISNLLRGHVQIFDGY
GESMIDYNHKATYVGVGVSLLEWF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccccacgctgcttccccgtctggcgccgctggcgcttgccctggccagtgca
ccgctggccgcgcaggagttcgtgcccagcaccgacacctcgccggccgcctgcgcggcg
atcaccaccgacgcggcgcgcctggcctgctacgaccgcctgttcgcgcacaccccgcag
gccaccgccgctgccgacgccgctgccgaggcggccgcgcaggcccgccgcgaagaacga
cagaccgcacgcgtgagccagggcgaagagaaactgcgcgaacgggtcagcgacctgttc
cgcccggcggcaccggacagcgcgctggccaacgccggccgcggttcgctgctggacagc
cgctgggagctggccgaggactccaagctgggacccttccagctgcgcgcctacaagccg
gtgtacctgctgcccgcgttctggaccagcgaccgcaacaccatgccgcactcgccgaac
ccggccaacagcgtgacgaccccgcaggtactcgacagtgccgagctgaagttccagatc
agcttcaagaccaagatcgccgagaacctgttcggcgacaacggcgacatctgggccggc
tacacccagagttcgcgctggcaggcctacaacagcgaggattcgcgcccgttccgcgaa
accaattacgaaccggaagtgatgatggtgttccgcaacggctactcgattggtggctgg
cgcgggcgcatgaccggcatcagcctcaaccaccagtccaacggacgggccgatccgctc
tcgcgcagctggaaccgggtcatgctcaacatcggcctggatcgcgagaactgggcgctg
gtgctgcgcccgtggtaccgcatcccggaaagccgcagcgaagacaacaatccggacatc
gaggattacatgggccgtggtgacgcgaccctgatctggaaccgcaacgggcatgaggtc
gcgctgatggcgcgccattcgctgcgcaccggcagccgctcccacggtgcactgcagctg
gactacggcttcccgatcagcaacctgctgcgtggccatgtgcagatcttcgacggctat
ggcgagagcatgatcgactacaaccacaaggccacctatgtgggcgtgggcgtgtcgctg
ctggagtggttctga

DBGET integrated database retrieval system