KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2737Help
Entry
BurJV3_2737       CDS       T01596                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
buj00330  Arginine and proline metabolism
buj00332  Carbapenem biosynthesis
buj01100  Metabolic pathways
buj01130  Biosynthesis of antibiotics
buj01230  Biosynthesis of amino acids
Module
buj_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BurJV3_2737
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BurJV3_2737
Enzymes [BR:buj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BurJV3_2737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEM52057
JGI: BurJV3_2737
UniProt: G0JVU3
Position
complement(3016669..3017826)
Genome map
AA seq 385 aa AA seqDB search
MTLHAANVASPFPQQALPPWRRAVLKVGSSLLAADGGGLSPRHALGLAQFVSANVLAGRE
VVIVSSGAVAAGRAILPRADEPGAAMAARQALAALGQAQLIGLWQRFFERPVAQVLLTHD
DLRNRRRYLNARATLSELLRLGALPVVNENDTVSVDELKLGDNDNLAATVAALVDADALF
IATDIDGLYSADPRAVADARPLHDVPELSDDVLAMAGGAGSRAGTGGMRTKLEAAAKAGR
LGIETYLFNGRSSDVVRALAQDRLFGTRIHAARSREAARKHWLRHAPLAEGAIIIDAGAA
LAMREKGASLLPGGITGAEGAFRRGDMVQVCWIAPQGRVCVARGVSQYAADDVRRIAGHH
SRDIQAVLGYNYGGSVVHRDDLVLP
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcacgccgccaacgttgcctcgccgttcccgcaacaggcgctgccgccgtgg
cgacgtgcagtgctgaaggtcggcagcagcctgctggcggccgatggtggcggcctgtcg
ccacgccacgcgctgggcctggcccagtttgtttccgccaacgtactggccgggcgcgag
gtggtgatcgtctcctccggtgcggttgcggcggggcgtgcgatcctgccgcgggccgat
gaacccggtgcggcgatggcggcgcggcaggccctggccgcgctcggccaggcgcagctg
atcgggctctggcagcgcttcttcgagcgcccggtggcgcaggtgctgctgacccacgac
gacctgcgcaaccgccgccgctacctcaatgcacgcgccacgctgagcgaactgctgcgg
ctgggtgcgctgccggtggtcaacgagaacgacactgtatcggtggatgaactcaagctc
ggcgacaacgacaacctggccgcgaccgtggccgcactggtcgatgccgatgcactgttc
atcgccaccgacatcgacggcctgtacagcgccgacccgcgcgccgtggccgacgcgcgg
cccctgcatgacgtgccggaactgagtgacgatgtgctggcgatggccggcggcgctggc
tcgcgcgccggcaccggcggcatgcggaccaagctggaggcggcggccaaggctggccgt
cttggcatcgagacctacctgttcaacggccgcagcagcgacgtggtacgcgcgctggcg
caggaccgcctgttcggcacccgcatccatgccgcacgcagccgcgaggccgcccgcaag
cactggctgcggcatgcgccgctggccgagggcgcgatcatcatcgatgccggtgcggca
ctggcgatgcgtgagaagggcgcctcgctgctgcccggtggcatcaccggtgcggagggc
gcgttccgccgcggtgacatggtgcaggtgtgctggatcgcgccgcaggggcgtgtctgt
gtcgcccgtggcgtcagccagtacgccgccgatgacgtgcgccggattgctggccaccat
tcgcgcgacatccaggccgtgctcggctacaactacggcggcagcgtcgtccatcgcgac
gacctggtgctgccatga

DBGET integrated database retrieval system