KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2858Help
Entry
BurJV3_2858       CDS       T01596                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BurJV3_2858
   01230 Biosynthesis of amino acids
    BurJV3_2858
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BurJV3_2858
   00051 Fructose and mannose metabolism
    BurJV3_2858
   00562 Inositol phosphate metabolism
    BurJV3_2858
Enzymes [BR:buj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BurJV3_2858
Exosome [BR:buj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BurJV3_2858
  Exosomal proteins of bladder cancer cells
   BurJV3_2858
  Exosomal proteins of melanoma cells
   BurJV3_2858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3134218..3134973)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGSRQFANELLGQVAAGLPLEGVDVVILPPLPYLGELVEDFGETGLAF
GAQDVSSNEKGAYTGEVCAAMLVEVGARYGLVGHSERRQYHHESSELVARKFAAAQHAGL
VPVLCVGETLEQREAGQTETVIASQLAPVLELVGAAGFAKAVVAYEPVWAIGTGRTASKE
QAQQVHAFIRGEVARIDARIADSLPIVYGGSVKPDNAGELFAQPDVDGGLVGGASLVAAD
FLAIARAAAAN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcaagatcgtcgccggaaactggaagctgcatggcagccgtcaattcgccaat
gaactgctggggcaggtggccgccgggctgccgctggagggggtggacgtggtgatcctg
ccgccgctgccgtacctgggcgagctggtcgaggacttcggcgagaccggcctggccttc
ggcgcgcaggacgtgagcagcaacgagaagggcgcctataccggcgaggtctgcgcggcc
atgctggtcgaggtcggggcccgctatggcctggtcggccactccgagcgccgccagtac
catcatgaaagcagcgagctggtcgcgcgcaagttcgccgccgcccagcatgccggcctg
gtgccggtgctgtgcgtgggcgagaccctggagcagcgcgaggccgggcagaccgaaacg
gtcatcgccagccagctggcgccggtgctggagctggtcggcgcggccggtttcgccaaa
gccgtggtcgcctacgagccggtctgggccatcggcaccggccgtaccgccagcaaggag
caggcgcagcaggtgcacgcgttcatccgtggcgaagtcgcgcgtatcgatgctagaatt
gctgattcactgcccattgtttacggcggtagcgtgaagcccgacaatgccggggaactg
ttcgcgcagccggatgtcgatggtgggctggtcggcggcgcctccctggtggccgcggac
ttcctggccatcgcacgggcggcggccgcgaactaa

DBGET integrated database retrieval system