KEGG   Stenotrophomonas maltophilia JV3: BurJV3_2867Help
Entry
BurJV3_2867       CDS       T01596                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BurJV3_2867
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BurJV3_2867
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BurJV3_2867
Enzymes [BR:buj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BurJV3_2867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3145225..3146034)
Genome map
AA seq 269 aa AA seqDB search
MSVSRLDACFQRLREQQRKALIPFVTAGDPSLEATVPVMHALVDAGADVIELGVPFSDPM
ADGPTIQRSSERALARGAGSRYVLQAVAQFRERDAQTPVVLMGYLNPVEIHGYAAFAKAA
VDAGVDGVLLVDLPPEEAGEALQAFDAAGLALVLLASPTTSEARADKLLALARGYLYYVS
FAGVTGASERLDSDAASARLQALRARASVPVVAGFGIKDADSAAAMARQADGVVVGSALV
AALAEAGSAEEAAQRARAFLAPLRQALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtatcccgactcgatgcctgtttccagcgtctgcgcgagcagcagcgcaaggcg
ctgatccccttcgtcacggccggtgatccctcgctggaagccaccgtgccggtcatgcac
gcactggtcgatgccggcgccgacgtgatcgaactgggcgtgccgttctccgacccgatg
gccgatggcccgaccatccagcgcagctccgaacgcgcgctggcgcgcggcgctggcagc
cgctacgtgctgcaggccgtggcgcagttccgcgagcgcgatgcgcagaccccggtggtg
ctgatgggctacctgaacccggtggagatccacggctacgcggcattcgccaaggccgcc
gtggacgccggcgtggacggcgtgctgctggtcgacctgccgccggaagaggcgggcgaa
gccctgcaggcgttcgacgcagccggcctggcgctggtgctgctggcgtcgccgactacc
agcgaggcgcgcgccgacaagctgctggcgctggcccgcggctatctctactacgtcagc
tttgccggtgtcaccggcgcgtccgagcgcctggacagcgatgccgctagtgcccgcctg
caggcgttgcgcgcgcgtgcgtcggtgccggtagtggcgggcttcggcatcaaggatgcc
gacagtgccgcggcgatggcccgccaggccgacggcgtggtggtgggcagcgcgctggtg
gcggcgctggccgaagcgggctcggcggaagaggccgcgcagcgcgcccgggccttcctg
gccccgctgcggcaggcgctggacgcgtaa

DBGET integrated database retrieval system