KEGG   Stenotrophomonas maltophilia JV3: BurJV3_3198Help
Entry
BurJV3_3198       CDS       T01596                                 

Definition
succinyl-CoA ligase (ADP-forming) subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BurJV3_3198
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BurJV3_3198
   00640 Propanoate metabolism
    BurJV3_3198
   00660 C5-Branched dibasic acid metabolism
    BurJV3_3198
Enzymes [BR:buj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BurJV3_3198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3537897..3539066)
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPAGKVAATPDEAVAAANSLGQGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAAAKMLGTKMATYQTAGVELPVNLVLVTTAGEIVKELYLSVLVDRGTKT
ITYIASSEGGVEIEQVAAETPELIHSLNVDFVEGVQGYHGRDFGFKLGLTAKQAGQFASI
MVNLYRLFNEKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKALVAMRDKTQEDP
TEVIASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKIVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacaactgcttgccgagtacggcatcccggtcccg
gccggcaaggtcgctgcgaccccggacgaagcggttgccgctgccaactccctgggccag
ggcccctggatggtcaaggcgcagatccacgctggcggccgcggcaaggctggcggcgtc
aagttctgcaagaccaccgacgacgtgaaggccgctgcggccaagatgctcggcaccaag
atggccacctaccagaccgctggcgttgaactgccggtcaacctggtgctggtgaccacc
gccggcgagatcgtcaaggaactgtacctgtcggtgctggtcgaccgtggcaccaagacc
atcacctacatcgcctcttcggaaggcggcgtggagatcgagcaggttgctgctgaaacc
ccggagctgatccactcgctgaacgtcgacttcgtcgaaggcgtgcagggttaccacggc
cgtgatttcggcttcaagctgggcctgaccgccaagcaggccggccagttcgccagcatc
atggtgaacctgtaccgcctgttcaacgaaaaggacctggcgctggttgaaatcaacccg
ctggccatcctggacgacggcaacctgtacgcgctggacggcaagttcgacagcgacgac
aacgccgcgttccgccagaaggccctggtcgccatgcgcgacaagacccaggaagatccg
accgaagtgatcgcttcggagctggacatcaactacgtcaccatggacggcaacatcggc
tgcatggtgaacggcgccggcctggccatggccaccatggacgtcatcaagctcaacggc
ggcgagccggcgaacttcctggacgtgggcggcggtgccaacaagcagcgcgtcatcgag
gcgttcaagctgatcctgtcctcggacaaggttgaaggcatcttcgtcaacatcttcggc
ggcatcgtccgctgcgacatgattgccgaaggcatcatcgccgccgtgaaggaagtgggc
gtcaaggttccggtcgtggtgcgcctggaaggcaccaacgtggaagaaggcaagcagctg
ctgcgcgacagcggcatggccatcatcccggctgacaacatcaacgatggcgccaagaag
atcgttgaagctgtcaagaacgctgcctga

DBGET integrated database retrieval system