KEGG   Stenotrophomonas maltophilia JV3: BurJV3_3378Help
Entry
BurJV3_3378       CDS       T01596                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
buj  Stenotrophomonas maltophilia JV3
Brite
Enzymes [BR:buj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BurJV3_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3743652..3744299
Genome map
AA seq 215 aa AA seqDB search
MTIDYAHARELMVEQQIRPWDVLDIKVLDVLARLPREAFVADAHRALAYADVELPIGHGQ
KMMKPVIEGRTLQALDLQPGDEVLEIGTGSGFLSACIGALARDVLSLEIDPELAAAARAR
LDASGLGTNVRVELADALAWQTERRFDVICVTGAVDVVPSQFASWLRPGGRLFVIHGRSP
AMEALLVKADGSSESLFETDIDYLRGAAPAPQFHL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgattacgcccacgcccgcgaactgatggtggaacagcagatccgtccctgg
gacgtgctggacatcaaggtgctcgacgtcctggcccgactgccgcgcgaggcctttgtc
gccgatgcacaccgggcactggcctacgccgatgtcgaactgccgatcggccatggccag
aagatgatgaagccggtcatcgagggccgtaccctgcaggcgctggacctgcagccgggt
gacgaagtgctggaaatcggcaccggcagcggcttcctgtcggcctgcatcggcgcgctg
gcgcgcgacgtgctgagcctggaaatcgacccggaactggccgccgccgcgcgcgcccgc
ctggacgcctccggcctgggcaccaacgtccgcgtagaattggccgacgccctggcctgg
cagaccgaacgccgctttgacgtgatctgtgtcactggtgcggtcgacgtggtgccgtca
cagttcgcttcgtggctgcgtccgggtggtcgcctgttcgtgatccatggccgttcgccg
gcgatggaggccctgctggtcaaggccgacggcagcagcgagtccctgttcgagaccgat
atcgattacctgcgtggtgccgccccggccccccagttccacctctga

DBGET integrated database retrieval system