KEGG   Stenotrophomonas maltophilia JV3: BurJV3_3470Help
Entry
BurJV3_3470       CDS       T01596                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BurJV3_3470
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BurJV3_3470
Enzymes [BR:buj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BurJV3_3470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3849879..3852236
Genome map
AA seq 785 aa AA seqDB search
MVKPSRARMRSAVLLGSLLALLPAMPALAADPTPAAEAPGPQLRAGSLMLIPAPATVQRG
QGSGITVRADTVLRAEGEAAQRVATQFADLLARSGGPRLALAKGKAASRSGGIRFEIVPT
FRDSGESYTLESTAQGVLVQAGNETGLFYGATTLAQLATGGSNGVLPAVQIQDAPRFSWR
GFMLDSARHFQSLDEIKRVLDAMAAHKLNTFHWHLTDDQGWRMEIKRYPKLTEVGSCRLP
AGDGGIDPASGDEHPYCGFYTQDQIREVIAYAAKLHIQVIPEIDVPGHATAAIAAYPELG
SINTPLKPISEWGVFPNLFNVEDSTVTFLENVLEEVIELFPAKYVHVGGDEAVKDQWEAS
RQVQQRMRALGIKDEMAMQSHIIKRLETFLEEHDRRLIGWDEILEGGLPPQATVMSWQGT
EGGLAAASAGHDVIMSPVGYLYLDYLQTASPNEPPGRPTQVNLGKLYNFEPVPAELAADK
RGHILGLQANMFTEHTRSYARLQHNLFPRLAAVAETGWSTPEHRDFRDFLARLPAQLQRY
RAWGLAYAQTPFEVGVDYTDDRAKNTVTVSLANPLGYEVRYSTDGQPVTAQSPLYQQPLT
AQLPAAVQAAAFYQGQMLAAKPTVADFSAQSLLSRRSDELLSCVGKKGLVLRLEDDGPRE
GPRAVFNVDIFQPCWRWPQAQLDGIGSVEVRAGRIPYYFQLAHDEPKRRFEKAKRAHGEM
LVRRGDCSGKVLAEVPLPAKPDADGFVTLRATLPKGTQGTSDLCINFTGDTRPAMWVLDE
VTLGK
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagccttcccgcgcccggatgcgcagcgcagtgctgctgggcagcctgctcgcc
ctgctgccggcgatgccggcgctcgccgccgatcccacgcccgccgctgaagcacccggc
ccgcagctgcgtgccggcagcctgatgctgattccggcgccggccactgtgcaacgcggc
cagggcagcggcatcaccgtgcgcgccgataccgtgctgcgcgccgaaggcgaggccgca
cagcgggtcgccacccagttcgccgatctgctggcccgcagcggtggcccgcgactggca
ctggccaagggcaaggccgcgtccaggagcggcggcatccgttttgagatcgtcccgacc
ttccgcgacagcggcgaaagctacacgctggaaagcaccgcacagggcgtgctggtgcag
gccggcaacgaaaccggcctgttctatggcgcgaccacgctcgcccagctcgccaccggc
ggcagcaacggggtactgccagcggtgcagatccaggatgcgccgcgcttcagctggcgc
ggtttcatgctcgactcggcacggcatttccagagcctggacgagatcaagcgcgtgctc
gacgcaatggctgcgcacaagctcaacaccttccattggcacctcaccgatgaccagggc
tggcgcatggagatcaagcgctacccgaagctgaccgaggtgggcagctgccgcctgccg
gccggcgacggtggcatcgatccggccagcggcgatgagcatccgtactgcggtttctac
acgcaggaccagatccgcgaagtgatcgcctatgccgcgaagctgcatatccaggtgatt
ccggaaatcgatgtgccggggcacgcgaccgcagcgatcgccgcgtatccggaactgggt
tcgatcaataccccgctgaagccgatcagcgaatggggcgtgttcccgaacctgttcaac
gtggaagacagcaccgtcaccttcctcgagaacgtcctggaggaagtgatcgaactgttc
ccggccaagtacgtgcacgtgggtggcgacgaggcggtgaaggaccagtgggaagcctcc
aggcaggtgcagcagcgcatgcgtgcactgggcatcaaggatgagatggccatgcagagc
cacatcatcaagcgcctggagacgttcctggaggaacacgaccggcgcctgatcggctgg
gatgagatcctcgaaggcgggctgccgccgcaggccacggtgatgtcgtggcagggcacc
gaaggtggcctcgctgcggccagtgccgggcacgacgtgatcatgtcgccggtcggctac
ctgtacctggactacctgcagacggcttcgccgaacgaaccgccgggccgcccgacccag
gtcaacctcggcaagctctacaacttcgagccggtgccagccgaactggccgccgacaag
cgcgggcacatcctcggcctgcaggccaacatgttcaccgagcacacgcgcagctatgca
cgcctgcagcacaacctgttcccgcgcctggccgccgtggccgagaccggctggagcacg
ccggaacaccgcgatttccgtgatttcctcgcacgcctgccggcacaactgcagcgctac
cgcgcctggggcctggcctatgcgcagaccccgttcgaagtaggcgtggactacaccgat
gatcgcgcgaagaacaccgtgaccgtgtcgctggccaatccgctgggctatgaagtgcgc
tacagcaccgatggccagccggtgaccgcgcagtcgccgctgtaccagcagccgctgacg
gcgcagctgcccgccgctgtgcaggccgccgcgttctaccagggccagatgctggccgcg
aagccgacggtcgcggacttcagcgcacaatcgctgctcagccgccgcagtgatgaactg
ctcagctgcgtaggcaagaagggcctggtgctgcgcctggaagatgatggcccacgcgag
ggcccccgtgcggtgttcaacgtggacatcttccagccgtgctggcgctggccgcaggcg
cagctggacggcatcggcagcgtggaagtccgcgcggggcgcattccgtactacttccag
ctggcccacgacgagcccaagcgtcgcttcgagaaggccaagcgcgcgcatggggagatg
ctggtgcgtcgcggcgactgcagcggcaaggtgctggccgaagtgccgctgccggccaag
ccggatgccgatggcttcgtgaccctgcgtgcgacgctgccgaagggcacccagggcacc
agtgacctgtgcatcaacttcaccggcgatacgcgcccggcgatgtgggtgctggatgag
gtcacgctggggaaatga

DBGET integrated database retrieval system