KEGG   Stenotrophomonas maltophilia JV3: BurJV3_3567Help
Entry
BurJV3_3567       CDS       T01596                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BurJV3_3567
Enzymes [BR:buj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BurJV3_3567
Exosome [BR:buj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BurJV3_3567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3954398..3955897
Genome map
AA seq 499 aa AA seqDB search
MTPRYVLAIDQGTTSSRAILFDRAGDIVGSAQREFAQIFPHPGWVEHDPREILTSVYATL
TELLSRGQIDPRHIAALGITNQRETTVVWDRATGQPIHNAIVWQSRQSHAICERLKSEGH
EALIRERTGLLIDAYFSATKVRWILDHVEGAQQRAERGELLFGTIDSWLVWNLSGGQAHV
TDYSNAARTLLFNIHTLDWDDELLALLDIPRAMLPQVRDSSAVYAHTRPQFFFDHPIPIA
GIAGDQQAALFGQACFQPGMVKNTYGTGCFMLMHTGAQAVRSRNGLLTTIAWGLDGRVEY
ALEGSIFIAGSVVQWLRDGLRMIERAGDSQALAAQVPDSGGAYLVPAFVGLGAPYWRSDV
RGAMFGLTRGTRKAHFVRAALEAMAYQTRDVLDAMQSDAGIALTELRADGGAIGNDFLAG
FQADILGVPLLRPRLTETTALGAAYLAGLAVGFWTSREQIAAQWGLDRRFEPQMEVARRE
KLYAGWQQAVAATLAFHVD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacgccccgctacgtgctggccatcgaccagggcaccaccagttcccgcgcgatcctg
ttcgaccgtgccggcgacatcgtcggcagcgcgcagcgcgagttcgcgcagatcttcccg
caccccggctgggtcgagcatgacccgcgcgagatccttaccagcgtgtatgccacgttg
accgaactgctcagccgcggacagatcgacccgcgtcatatcgccgcactgggcatcacc
aaccagcgcgaaaccaccgtggtctgggaccgtgccaccggccagccgatccacaacgcc
atcgtctggcaatcgcggcagagccacgccatctgcgagcggctcaaatccgaggggcat
gaagcgctgatccgcgagcggaccggcctgctgatcgacgcctatttctccgccaccaag
gtacgctggatcctcgaccacgtggagggtgcgcagcaacgcgccgaacgtggcgagctg
ctgttcggcaccatcgacagctggctggtgtggaacctgagcggtggccaggcgcatgtg
accgactacagcaacgcggcgcgcacgctgctgttcaacatccacacgctggactgggat
gacgagctgctggccctgctcgacatcccacgcgcgatgctgccgcaggtgcgcgactcc
agcgcggtatacgcgcatacccggccgcagttcttcttcgaccatccgatcccgatcgcc
ggcatcgccggtgaccagcaggcggcgctgttcggccaggcctgcttccagccgggcatg
gtcaagaacacctatggcaccggctgtttcatgctgatgcataccggtgcgcaggcggtg
cggtcgcgcaacggcctgctgaccaccattgcctggggcctggacggacgcgtggagtac
gcgctggaaggctcgatcttcatcgccggctcggtggtgcaatggctgcgcgatgggctg
cgcatgatcgaacgcgcaggtgacagccaggcactggctgcgcaggtgcctgacagtggc
ggcgcctacctggtgccggcgttcgtcggcctcggcgcgccctattggcgcagtgacgtg
cgcggtgcgatgttcgggttgacccgcggcacccgcaaggcgcacttcgtgcgcgccgcg
ctggaagcgatggcctaccagacccgcgacgtgcttgatgcgatgcagtccgatgcgggt
atcgcgctgaccgagctgcgcgccgatggcggtgcgatcggcaacgacttcctggccggt
ttccaggccgacatcctcggtgtgccgctgctgcggccgcgactgaccgagaccaccgcg
ctgggtgcggcctacctggccggcctggcggtggggttctggaccagccgcgaacagatc
gccgcgcagtggggcctggaccggcgcttcgagccccagatggaggtggcgcggcgcgag
aagctgtatgcgggatggcagcaggcggtggccgccaccctcgccttccacgtcgattga

DBGET integrated database retrieval system