KEGG   Stenotrophomonas maltophilia JV3: BurJV3_4068Help
Entry
BurJV3_4068       CDS       T01596                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
buj  Stenotrophomonas maltophilia JV3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:buj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BurJV3_4068
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BurJV3_4068
Enzymes [BR:buj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BurJV3_4068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4522868..4523413)
Genome map
AA seq 181 aa AA seqDB search
MSTPIQDISLTTIDGQPSSLADYQGKVLLLVNVASKCGLTPQYEGLQALYAEKHAQGLEV
LGFPANNFLGQEPGSEAEIQQFCQLTYDVSFPMFSKISVAGEDTHPLYQQLTAAQPQSIG
EGPLRERLASKEIPIHPAPAVLWNFEKFLVGRDGKVVARFAPDVAADDARLREAIEAALA
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccccaatccaggacatttccctcaccaccatcgacggccagccgtcctcgctt
gccgactaccagggcaaggtactgctgctggtcaacgttgcctccaagtgtggcctgacc
ccgcagtacgaaggcctgcaggcgctgtatgcggaaaagcacgcgcagggcctggaagtg
ctgggcttccccgccaacaacttccttggccaggagccgggcagcgaggccgagatccag
cagttctgccagctcacctacgatgtcagtttcccgatgttctccaagatcagcgtggct
ggcgaggacacccacccgctgtaccagcagctgaccgctgcgcagccgcagtcgatcggt
gaaggcccgctgcgcgagcgcctggccagcaaggagatcccgatccatccggcaccggcg
gtgctgtggaacttcgagaagttcctggtcggccgcgatggcaaggtcgtcgcccgcttt
gcgccggacgtggccgccgatgatgcgcgcctgcgcgaggccatcgaggcggcactggcg
gcctga

DBGET integrated database retrieval system