KEGG   Burkholderia sp. KJ006: MYA_0344Help
Entry
MYA_0344          CDS       T02110                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
buk  Burkholderia sp. KJ006
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYA_0344
  Amino acid metabolism
   00340 Histidine metabolism
    MYA_0344
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MYA_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:370071..371387
Genome map
AA seq 438 aa AA seqDB search
MAITIRKLDSTRDGFDAELRTLLAFEASEDEAIEQSVAKILADVKSRGDAAVLEYTNRFD
RLDADSVAALELPQDALQAALDGLAPKARAALEAAAARVRAYHEKQKIECGTHSWQYTES
DGTVLGQKITPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVGEIVMVVPTPDGVKNDLV
LAAALLGGVDRVFTIGGAQAVGALAYGTATVPPVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPSWVAMDLFSQAEHDELAQSILLCPDGAFLERVEKAIDELLPTM
PRQDVIRASLEGRGALIKVRDMAEACRIANDIAPEHLEISALEPQQWGQQIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRSSVIEVSAEGAQTLGEIASELA
YGEGLQAHARSAELRMRG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaccatccgcaaactcgattcgacgcgcgacggcttcgacgccgagctgcgt
acgttgctcgccttcgaggcgagcgaggacgaagcgatcgagcagtcggtcgcgaagatc
ctcgccgacgtgaaatcgcgcggcgacgccgcggtgctcgaatacacgaaccgcttcgac
cggctggacgcggacagcgtcgccgcgctcgaactgccgcaggacgcgctgcaggccgcg
ctcgacggcctcgcgccgaaggcgcgcgcggcgctcgaagccgcggccgcacgcgtgcgt
gcgtaccacgagaagcagaagatcgagtgcggcacgcacagctggcagtacacggaaagc
gacggcacggtgctcggccagaagatcacgccgctcgaccgcgtcgggctctacgtgccg
ggcggcaaggccgcctatccgtcgtcggtgctgatgaacgcgattccggcgcgcgtggcg
ggcgtcggcgagatcgtgatggtcgtaccgacccccgacggcgtgaagaacgacctcgtg
ctggccgccgcgctgctcggcggcgtcgatcgcgtgttcaccatcggcggcgcgcaggcg
gtcggcgcgctcgcgtacggcacggccacggtgccgccggtcgacaagatctgcggcccg
ggcaatgcgtacgtcgcatcggcgaagcgccgcgtgttcggcacggtcggcatcgacatg
atcgccggcccgtcggaaatcctcgtgctgtgcgacggcacgaccgatccgagctgggtt
gcgatggacctgttctcgcaggccgagcacgacgagctcgcgcagtcgatcctgctgtgc
ccggacggcgcgttcctcgagcgcgtcgagaaggcgatcgacgagctgctgccgacgatg
ccgcgtcaggacgtgatccgcgcgtcgctcgaagggcgcggcgcgctgatcaaggtgcgc
gacatggccgaagcgtgccggatcgcgaacgacatcgcgcccgagcacctcgaaatttcc
gcgctcgagccgcagcaatggggccagcagatccgccatgccggcgcgatcttcctcggc
cgctacacgagcgagagcctcggcgattactgcgccggcccgaaccacgtgctgccgacc
tcgcgcaccgcgcgcttctcgtcgccgctcggcgtgtacgacttcatcaagcgctcgagc
gtgatcgaagtcagcgccgaaggcgcgcagacgctcggcgagatcgcctccgagctcgcc
tacggcgaagggctgcaggcgcatgcgcgcagcgccgaactgcggatgaggggatga

DBGET integrated database retrieval system