KEGG   Burkholderia sp. KJ006: MYA_0439Help
Entry
MYA_0439          CDS       T02110                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
buk  Burkholderia sp. KJ006
Brite
Enzymes [BR:buk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MYA_0439
Secretion system [BR:buk02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   MYA_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:472110..472820
Genome map
AA seq 236 aa AA seqDB search
MASLALAVTMATLGCTAQADQTTDKLKATLQARLGSDAPIKSVSKSPVAGLYEVNLGSQI
IYSDAAGDYVLLGDLVDTKTHKNLTDARLSDLNRIDFASLPFANAIKVVKGNGARKIAVF
SDPNCPYCKRLETTLQSIDNVTVYTFLYPVLSPDSTAKSKAIWCASDRAKTWESWMIDHR
APSGAGTCDTTALDKNLALGHGMNVTGTPTIFLPDGRRLPGAVSAEQLNQALASSK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgctggcgctcgccgtcacgatggcgacgcttggctgtaccgcgcaggccgac
caaaccaccgacaagctgaaagccacgctgcaggcgcgtctcggcagcgacgcgccgatc
aagagcgtgtcgaaatcgccggtcgcgggcctctatgaggtgaacctcggctcgcagatc
atctatagcgacgcagcgggcgactacgtgctgctcggcgatctcgtcgacaccaagacg
cacaagaacctgaccgacgcacgcctgtccgatctgaaccggatcgatttcgcgagcctg
ccgttcgcgaacgcgatcaaggtcgtgaagggcaacggcgcacgcaagatcgcggtgttc
tccgaccccaactgcccgtactgcaagcggctcgagacgacgctgcagtcgatcgacaac
gtgaccgtctacacgttcctgtacccggtgctgtcgccggattcgaccgcgaagtcgaag
gcgatctggtgcgcgagcgatcgcgcgaagacgtgggaaagctggatgatcgaccatcgc
gcgccgtccggcgccggcacctgcgacaccaccgcgctcgacaagaacctcgcgctcggc
cacgggatgaacgtcaccggcacgccgacgatcttcctgccggacggtcgccgcctgccg
ggcgccgtttcggccgagcagctgaaccaggcgctcgcgtcgagcaagtaa

DBGET integrated database retrieval system