KEGG   Burkholderia sp. KJ006: MYA_0500Help
Entry
MYA_0500          CDS       T02110                                 

Definition
glutamate 5-kinase / RNA-binding C-terminal domain PUA
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
buk  Burkholderia sp. KJ006
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYA_0500
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYA_0500
Enzymes [BR:buk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MYA_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:542379..543497
Genome map
AA seq 372 aa AA seqDB search
MRSIIADSKRLVVKVGSSLVTNDGKGLDHAAIGRWAAQIAALRAQGKEVVLVSSGAIAEG
MQRLGWNKRPREIDELQAAAAVGQMGLAQVYESRFTEHRIRTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQTGLFT
ADPRKDPNATLVAEASAGAPELESMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
READVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDAGAVEKLRDGGKSL
LPIGVIDVQGAFARGEVIACVGPDGREVARGLTNYSSAETKLIHRKPSGEIETVLGYMLE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgatcatcgcggattcgaagcgattggtggtgaaggtgggttcaagcctcgtg
accaacgacggcaagggcctcgatcatgcggcaatcggccgctgggcggcgcagatcgct
gcgctgcgcgcgcagggcaaggaagtggtgctggtcagctcgggcgcgatcgccgagggg
atgcagcgtctcggctggaacaagcgtccgcgcgaaatcgacgaattgcaggccgccgcg
gcggtcgggcagatggggctcgcgcaagtctacgaaagccgcttcaccgagcatcgcatt
cgcaccgcgcagatcctgctcacgcatgccgacctggccgatcgcgagcgctatctgaac
gcgcgctcgacgttgctcacgctgctgcgcctcggcgtcgtgccgatcatcaacgagaac
gacacggtggtcaccgacgaaatcaagttcggcgacaacgacacgctcggcgcgctcgtc
gcgaacctgatcgaaggcgatgcactgatcatcctgaccgaccagacggggttgttcacc
gccgatccgcgcaaggatccgaacgcaacgctcgtcgcggaagcgagcgcgggcgcgccg
gagctcgagtcgatggcgggcggcgcggggtcgagcctcggccgcggcgggatgctgacg
aagatcctcgcagcgaagcgcgccgcgcacagtggcgcgaacaccgtgatcgcgagcggc
cgcgaggccgacgtgctggtgcggctggccgcgggtgaggcgatcggcacgcaactgatc
gcacggaccgcgcggatggccgcgcgcaagcaatggatggccgatcatctgcaggtgcgc
gggcacgtcgtgatcgatgcgggcgcagtcgagaagctgagggacggcggcaagagcctg
ctgccgatcggcgtgatcgacgtgcagggcgcgtttgcgcgcggcgaggtgatcgcgtgc
gtcggcccggacgggcgtgaagtggcgcgcggcctcacgaactacagcagcgcggaaacg
aagctgattcaccgcaagccgagcggcgagatcgagacggtgctcggctacatgctcgaa
cccgagctgattcatcgcgacaacctcgtgctggtctga

DBGET integrated database retrieval system